DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-4 and Zmynd15

DIOPT Version :9

Sequence 1:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001025100.1 Gene:Zmynd15 / 574428 MGIID:3603821 Length:736 Species:Mus musculus


Alignment Length:211 Identity:36/211 - (17%)
Similarity:60/211 - (28%) Gaps:75/211 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SRARHQRGGQQSKDKQEQQDKEQSPSPTEEKE----LPYRV--------EHSDIYGRYLVAN--- 64
            |....|...::...::|:.:.|::|...:.::    .|..:        ||..|.|..|:.:   
Mouse   158 SEVTQQEASREEGSREERPEDERAPEKRKGQKNAEAAPLHLSCLLLVTDEHGTILGIDLLMDGAQ 222

  Fly    65 ------------------------------------RQLEAGETLIREE----------PLAIGP 83
                                                |||..|:..:..|          .||..|
Mouse   223 GSVGQNPGTENLAPRAYALLCHSMACPMGSGDPRKPRQLTVGDAHLHRELESLVPRLGVKLAKTP 287

  Fly    84 CVSGDP------------VCLGCYHPVSLKADQYRCPGCAWPL-CGSTCAGLKHRHGHTETECQL 135
            ..:..|            .|..| |..|.:.....||.|:..| ||..|.....|....:...:.
Mouse   288 MRTWGPRPGFTFASLRARTCHVC-HKHSFEVKLTPCPQCSAVLYCGEACLQADWRRCPDDVSHRF 351

  Fly   136 YAERRAVAGELLTERA 151
            :..|.:...|.:.|.|
Mouse   352 WCPRLSAFMERVGELA 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
Zmynd15NP_001025100.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..94
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..192 5/33 (15%)
zf-MYND 307..353 CDD:280009 12/46 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..583
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 696..736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.