DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-4 and zmynd12

DIOPT Version :9

Sequence 1:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001007305.1 Gene:zmynd12 / 492338 ZFINID:ZDB-GENE-041114-133 Length:365 Species:Danio rerio


Alignment Length:229 Identity:51/229 - (22%)
Similarity:80/229 - (34%) Gaps:64/229 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 EGKLFWCCCRRCSDPRELG-TDCSALVCATCRTGSVRAVDPLQQTGDWACDRCAHKMGATEVERQ 371
            |.||    |..|..|.:|. |.|  ||...|...        .|..||           |.:..:
Zfish    14 EKKL----CEICQKPAKLQCTKC--LVTFYCNLD--------HQQADW-----------TSIHEK 53

  Fly   372 ----LDRINNDLEDIDVHDIPGLENFLLRYRDVLRPNHYLLLSAKYSLCQIYGRTEGYLLPQMSP 432
                |..||..:....:.|                .||:...:.|...|.|          :|:.
Zfish    54 ACPLLVSINTPVPSGTLSD----------------QNHHHKETLKKQKCLI----------EMAH 92

  Fly   433 EDIARKESYCREFLEIVD---VLDPGLTRLRGLIMYELHAPVMVLAQSAFQSGQISR-QEFQRRL 493
            .: |||....:.|.:::.   :....:.|:.|....||....::|||:....|.:|: ||:..:.
Zfish    93 LE-ARKWVSMKRFQDVLPAALLFQHWIMRVYGSCTVELVPAYLLLAQANIGIGSLSQAQEYLSKA 156

  Fly   494 KEVV-KLLQVSRDIL--LMEPEGSTENAMGQAAA 524
            :.:| |....|..:|  |....|....|||:.|:
Zfish   157 EWIVMKTADCSHTVLHQLHRTLGRLHAAMGKQAS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
zmynd12NP_001007305.1 zf-MYND 18..55 CDD:280009 13/57 (23%)
TPR_12 168..240 CDD:290160 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.