DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-4 and Zmynd12

DIOPT Version :9

Sequence 1:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001014900.2 Gene:Zmynd12 / 332934 MGIID:2140259 Length:363 Species:Mus musculus


Alignment Length:193 Identity:40/193 - (20%)
Similarity:56/193 - (29%) Gaps:79/193 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 CRRCSDPRELGTDCSALVCATCRTGSVRAVDPLQQTGDW------ACD-----RCAHKMGATEVE 369
            |..|..|.|       .:|..|..  .....|:.|..||      .|.     |.......:|.|
Mouse    17 CEVCEAPAE-------RMCTACTV--TYYCGPVHQKADWDSIHAKICQLLIPLRTTMPFYNSEEE 72

  Fly   370 RQLDRINNDLEDIDVHDIPGLENFLLRYRDVLRPNHYLLLSAKYSLCQIY---GRTEGYLLPQMS 431
            ||             |.:..|:.         |..|  |:...|::.|.|   ||.|        
Mouse    73 RQ-------------HGLQQLQR---------RQKH--LIEFCYTVAQKYLFEGRHE-------- 105

  Fly   432 PEDIARKESYCREFLEIVDVLDPGLTRLR------GLIMYELHAPVMVLAQSAFQSGQISRQE 488
                              |.:...|..||      ||...||....::||:::...|:|.:.|
Mouse   106 ------------------DAVPAALHSLRFRMNVHGLSSVELVPAYLLLAEASLGLGRIVQAE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
Zmynd12NP_001014900.2 zf-MYND 17..54 CDD:280009 10/45 (22%)
TPR_12 92..156 CDD:290160 19/85 (22%)
TPR repeat 132..162 CDD:276809 5/19 (26%)
TPR repeat 171..201 CDD:276809
TPR repeat 214..242 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.