DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-4 and smyd1a

DIOPT Version :9

Sequence 1:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_991103.2 Gene:smyd1a / 321245 ZFINID:ZDB-GENE-030131-9825 Length:485 Species:Danio rerio


Alignment Length:465 Identity:104/465 - (22%)
Similarity:167/465 - (35%) Gaps:128/465 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TEEKELPYRVEHSDIYGRYLVANRQLEAGETLIREEPLAIGPCVSGD----PVCLGCYHPVSLKA 102
            |.||..|..|..:.:.||.|...|.|.|||.:..|...|   .|..|    .||..|:.   .:.
Zfish     2 TVEKTDPVEVFGAGLKGRGLRGTRDLSAGEVVFAEASFA---AVVLDSLSLQVCHSCFR---RQV 60

  Fly   103 DQYRCPGCAWP-LCGSTC---AGLKHRHGHTETECQLYAERRAVAGELLTERAGPAEVRDLYELV 163
            :.:||..|.:. .|..||   |..:||     .||...   |.:.      :|....||      
Zfish    61 NPHRCAQCKFAHYCDRTCQRAAWDEHR-----KECSAI---RNIG------KAPNENVR------ 105

  Fly   164 MIVRIL-LLRQH----DPEQFALIARMESHTEERRQNAVLWRHYEEKV-VQRLRVTW--QLEDLE 220
            ::.||| .:::|    ...|...:..:|.|........:    .|.|| |:.....|  :.:.:.
Zfish   106 LVARILWRIQKHTGLVSDSQLTTLDMLEDHLSRMTPEDL----KELKVDVKTFYTYWPKKSKAVG 166

  Fly   221 AEQVHEVCGILDVNCFEIG-QNGAKA--RTLYPSAFLLAHDCTPNTA---HTDDPSSFEILLRTS 279
            .:.|..:.|::..|.|.:. |.|.::  ..|:|:..|:.|||.||..   :..|.|:.:....:|
Zfish   167 EDYVSHLFGVISCNGFTLSDQRGLQSVGIGLFPNLCLVNHDCWPNCTVILNHGDQSALDASFHSS 231

  Fly   280 RRVRER--------EALTLSYAYTLQGTLKRRAFMHEGKLFWCCCRRCSD-----------PREL 325
            ||:..|        :.||:||...|..:..|:..:.:...|.|.|..|.:           |.|.
Zfish   232 RRIELRALEPISAGQELTVSYVDFLSVSTDRQRLLQQQYYFDCKCEHCVNGTKDELMTAVKPTED 296

  Fly   326 GTDCSALVCATCRTGSVRA---VDPLQQTGDW-----ACDRCAHKMGATEVERQLDRINNDLEDI 382
            |...||.|.......|::|   ::..:..|::     .|..|..|....            ..|.
Zfish   297 GKQPSAEVVKQLTDFSLQALVKIEAARAQGNFHEVIRICRECLEKQDPV------------FADT 349

  Fly   383 DVHDIPGLE------NFLLRYRD--------------VLRPN----------------HYLLLSA 411
            :||.:..|.      :||.::::              :..||                |..|:.|
Zfish   350 NVHVLRVLSTASEVLSFLQQFQEAAGYAQRMVDGYMKLYHPNNAQLGMAIMRAGVTHWHAGLIEA 414

  Fly   412 KYSL-CQIYG 420
            .:.| |:.||
Zfish   415 AHGLICRAYG 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
smyd1aNP_991103.2 zf-MYND 52..90 CDD:280009 11/45 (24%)
SET <203..252 CDD:279228 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11197
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.