DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-4 and Smyd5

DIOPT Version :9

Sequence 1:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001101340.1 Gene:Smyd5 / 312503 RGDID:1309153 Length:417 Species:Rattus norvegicus


Alignment Length:379 Identity:74/379 - (19%)
Similarity:122/379 - (32%) Gaps:129/379 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SDIYGRYLVANRQLEAGETLIREEPL--------------AIGPC-------------VSGDPVC 91
            |...|:.|.|.:.:..|||:..|.||              |...|             ::|.|..
  Rat    29 SSAKGKGLFATQLIRKGETIFIERPLVASQFLWNALYRYRACDHCLRALEKAEENAQRLTGKPGQ 93

  Fly    92 LGCYHP--VSLKADQYR-CPGCAWPLCGSTCAGLKHRHGHTETECQLYAERRAVAGELLTERAGP 153
            : ..||  .|::.|.:: ||.|....|.:              ||:|.|..:  ..::|.  .||
  Rat    94 V-LPHPELCSVRKDLHQNCPRCQVTYCSA--------------ECRLAAAEQ--YHQILC--PGP 139

  Fly   154 AEVRDLYELVMIVRILLLRQHDPE--QFALIARMESHTEERRQN---AVLWRHY-------EEKV 206
            ::....:.|..:........:.||  ...|:|||.:..::.:..   ..|:.|:       ||::
  Rat   140 SQDDPRHPLNKLQEAWRSVHYPPETASIMLMARMVATVKQAKDKDHWVRLFSHFCSKTANEEEEI 204

  Fly   207 VQRL---RVTWQLEDLE---AEQVHE------------------------------------VCG 229
            |.:|   :...|||.|.   .|.::|                                    .|.
  Rat   205 VHKLLGDKFKGQLELLRRLFTEALYEETLSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWVHACD 269

  Fly   230 ILDVNCFEIGQNGAKARTLY---------------PSAFLLA----HDCTPNTAHTDDPSSFEIL 275
            .|::...|..|.......||               ...|:|.    |.|.||...:...::|.:.
  Rat   270 ALELKPQEREQLDTFIDQLYKDIEAATGEFLNCEGSGLFVLQSCCNHSCVPNAETSFPENNFLLH 334

  Fly   276 LRTSRRVREREALTLSYAYTLQGTLKRRA---FMHEGKLFWCCCRRC----SDP 322
            :.....:...|.:.:||....|....|.:   .:.|..||.|.|.:|    .||
  Rat   335 VTALEDIEPGEEICISYLDCCQRERSRHSRHKILRENYLFVCSCPKCLAEADDP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
Smyd5NP_001101340.1 DUF4599 68..144 CDD:292015 19/94 (20%)
SET <298..351 CDD:214614 8/52 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.