DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-4 and Smyd1

DIOPT Version :9

Sequence 1:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001100065.1 Gene:Smyd1 / 297333 RGDID:1305105 Length:490 Species:Rattus norvegicus


Alignment Length:447 Identity:95/447 - (21%)
Similarity:159/447 - (35%) Gaps:133/447 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VEHSDIY-----GRYLVANRQLEAGETLIREEPLAIGPCVSGDPVCLGCYHPVSLKADQYRCPGC 110
            :|:.:::     ||.|.|.::..|.:.:..|.  |....|....:...|:.....:...:||..|
  Rat     6 MENVEVFTSEGKGRGLKATKEFWAADVIFAER--AYSAVVFDSLINFVCHTCFKRQERLHRCGQC 68

  Fly   111 AWP-LCGSTC---AGLKHRHGHTETECQLYAERRAVAGELL---------TERAGPAEVRDLYEL 162
            .:. .|..||   |.|.|::     ||........|..|.:         .||.|..    |.|.
  Rat    69 KFAHYCDRTCQKDAWLNHKN-----ECSAIKRYGKVPNENIRLAARIMWRVEREGTG----LTEG 124

  Fly   163 VMIVRILLLRQHDPEQFALIARMESHTEERRQNAVLWRHYEEKVVQRLRVT-------W--QLED 218
            .::               .:..:::|.|          |:.|:..:.|||.       |  |.:.
  Rat   125 CLV---------------SVDDLQNHVE----------HFGEEEQKELRVDVDTFLQYWPPQSQQ 164

  Fly   219 LEAEQVHEVCGILDVNCFEIG-QNGAKA--RTLYPSAFLLAHDCTPNTA-------HTDDPSSF- 272
            ...:.:..:.|:::.|.|.:. |.|.:|  ..::|:..|:.|||.||..       |....|.| 
  Rat   165 FSMQYISHIFGVINCNGFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFH 229

  Fly   273 ---EILLRTSRRVREREALTLSYAYTLQGTLKRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVC 334
               .|.||...::.|.|.||:||...|..:.:||..:.:...|.|.|..|.  :.|..|....| 
  Rat   230 TQMRIELRALGKISEGEELTVSYIDFLHLSEERRQQLKKQYYFDCSCEHCQ--KGLKDDLFLAV- 291

  Fly   335 ATCRTGSVRAVDPLQQTGDWACDRCAHKMGATEVERQLDRINND-LEDIDVHDIPGLENFLLRYR 398
                     ..||               ..:.||.:::.:.:.| ||.||.....||      |.
  Rat   292 ---------KEDP---------------KPSQEVVKEMTQFSKDTLEKIDKARSEGL------YH 326

  Fly   399 DVLRPNHYLLLSAKYSLCQ--------IYGRTEGYLLPQMSPEDIARKESYCREFLE 447
            :|::            ||:        ::..|..|:|..:|  .::...||.:.|.|
  Rat   327 EVVK------------LCRECLEKQEPVFADTNLYVLRLLS--IVSEVLSYLQAFEE 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
Smyd1NP_001100065.1 zf-MYND 52..90 CDD:280009 10/42 (24%)
SET <194..257 CDD:214614 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.