DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-4 and Zmynd15

DIOPT Version :10

Sequence 1:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001099270.1 Gene:Zmynd15 / 287457 RGDID:1309845 Length:738 Species:Rattus norvegicus


Alignment Length:111 Identity:27/111 - (24%)
Similarity:35/111 - (31%) Gaps:28/111 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RQLEAGETLIREE----------PLAIGPCVSGDP------------VCLGCYHPVSLKADQYRC 107
            |||..|:..:..|          .||..|..:..|            .|..| |..|.:.....|
  Rat   261 RQLTVGDAHLHRELESLVPRLGVKLAKTPMRTWGPRPGFTFASLRARTCHVC-HKHSFEVKLTPC 324

  Fly   108 PGCAWPL-CGSTCAGLKHRHGHTETECQLYAERRAVAGELLTERAG 152
            |.|:..| ||..|.....|....:...:.:..|.|.    ..||||
  Rat   325 PQCSAVLYCGEACLQADWRRCPDDVSHRFWCPRLAA----FMERAG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 SET_SMYD <230..319 CDD:380997
Zmynd15NP_001099270.1 zf-MYND 309..355 CDD:460312 12/46 (26%)
MSS51_C 480..674 CDD:466330
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.