DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-4 and set6

DIOPT Version :9

Sequence 1:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_596514.1 Gene:set6 / 2541370 PomBaseID:SPBP8B7.07c Length:483 Species:Schizosaccharomyces pombe


Alignment Length:300 Identity:59/300 - (19%)
Similarity:99/300 - (33%) Gaps:92/300 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YGRYLVANRQLEAGETLIREEPLAIGPCVSGDP-----VCLGCYHPVSLKADQYRCPGCA----- 111
            :|:..||...:..|:.:||:..    ..:|.|.     .|..|   ...|....||..|.     
pombe    14 FGKGTVATDNIPIGKIIIRKRV----DILSLDSANLTRTCSTC---TEEKVKTQRCAACKIIHYC 71

  Fly   112 --------WPLCGSTCAGLK--HRHGHTETECQLYAERRAVAGELLTERAGPAEVRDLYELVMIV 166
                    ||.....|..|:  .::|...:.|:|                             ::
pombe    72 SKGCQKADWPFHKLECKALQASKQNGILPSVCRL-----------------------------LI 107

  Fly   167 RILLLRQHDPEQFALIARMESHTEERRQNAVLWRHYEEKVVQRLRVTWQLEDLEAEQVHEVCGIL 231
            |:.||.|.:|   |:|..||.|..|               .|.:..:|...:|.|........|.
pombe   108 RLYLLWQKNP---AIIEPMEGHQNE---------------FQAVSSSWSDAELIASAASHYTQIY 154

  Fly   232 DVNCFE--IGQNGAKARTLYPSAF------------LLAHDCTPNTAHTDDPSSFEILLRTSRRV 282
            ....|:  ..:....|..|..|:|            .|.|.|.||.....|.:..:::  :.|.:
pombe   155 QAELFQKLFCRLAVNAMNLVTSSFDSLGMCLDTILCRLNHSCDPNCQIIFDGAIVQLV--SKRDI 217

  Fly   283 REREALTLSYA-YTLQGTLKRRAFMHEGKLFWCCCRRCSD 321
            ::.|.|.:||. ..|..:::::..:.: ..|.|.|.||.:
pombe   218 KKDEQLFISYIDIRLPKSIRQKQLLKK-YFFSCYCPRCEN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
set6NP_596514.1 SET 5..483 CDD:225491 59/299 (20%)
zf-MYND 49..87 CDD:280009 8/40 (20%)
SET <142..227 CDD:279228 17/86 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1875
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.