DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-4 and set5

DIOPT Version :9

Sequence 1:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_588413.1 Gene:set5 / 2538853 PomBaseID:SPCC1739.05 Length:319 Species:Schizosaccharomyces pombe


Alignment Length:182 Identity:43/182 - (23%)
Similarity:66/182 - (36%) Gaps:47/182 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 FLLA----HDCTPNTAHTDDPSSFEILLRTSRRVREREALTLSYAYTLQGTLKRRAFMHEGKLFW 313
            |||.    |||:||..||.:|...::.:...|.:...|.:..:|....:...:|:..:.|...|.
pombe    97 FLLGSRMNHDCSPNVKHTWNPRLDQVTVHAVRDIEAGEEILTTYIDLHKSHTERQKILLEHFGFK 161

  Fly   314 CCCRRCS-DPRELGTDCSALVCATCRTGSVRAVDPLQQTGDWACDRCAHKM------GATEVERQ 371
            |.|..|| :.|:                 :|.:..|::......||...||      ||....|.
pombe   162 CYCSVCSVEERK-----------------IRKISDLRRKQLAYYDRTMAKMCIVNPRGALRALRH 209

  Fly   372 LDRINNDLEDIDVHDIPGLENFLLRYRDVLRPNHYLLLSAKYSLCQIYGRTE 423
            ...|.:             |..|....|::     .||.| :.||.|:|..|
pombe   210 RIHIAH-------------EELLFGRLDII-----ALLDA-FRLCVIHGDFE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
set5NP_588413.1 SET <1..319 CDD:225491 43/182 (24%)
SET 4..147 CDD:214614 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.