DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-4 and set-30

DIOPT Version :9

Sequence 1:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_508850.2 Gene:set-30 / 180772 WormBaseID:WBGene00022499 Length:560 Species:Caenorhabditis elegans


Alignment Length:324 Identity:65/324 - (20%)
Similarity:113/324 - (34%) Gaps:91/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SHTEERRQNAVLWRHYEE------------KVVQRLR------------VTWQLEDLEAEQVHEV 227
            ::.|.:|....:|.|..:            |...|::            ||:||........|.:
 Worm   117 NNRESKRSVMEIWEHCADMKKDENAMKSFKKTYDRVKQFGDTNHLMDEEVTFQLHSRNFINRHSI 181

  Fly   228 CGILDVNCFEIGQNGAKARTLYPSAFLLAHDCTPNTAHTDDPSSFEILLRTSRRVREREAL---- 288
            ..:..:.  |||:.      ||.......|.|.||..:     |...::...|.:.:...|    
 Worm   182 SNVDYLR--EIGKG------LYLDLCKYDHSCRPNAIY-----SCNGIVAKLRALHDNVDLENVE 233

  Fly   289 TLSYAYTLQGTLK--RRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRT-----------G 340
            |..|.|......|  ||..:.|...|.|.|.||.||.:  ...::::|..|.:           |
 Worm   234 TTHYTYIELPPCKIQRRHMLKETWYFECHCERCDDPDD--NWLTSVLCPVCISKTEYRKTIKLHG 296

  Fly   341 SVRAVDPLQQTGDWACDRCAHKM----------GATEVERQLDRINNDLED-IDVHDIPGLENFL 394
            .....:|  :|.:..||||:..:          |...:.|.::...::.:| |::..|  .:..|
 Worm   297 PEAYANP--ETLEIVCDRCSTTLDREYIFMALDGMRTIRRTVEGAEDETKDPIELLKI--YQGAL 357

  Fly   395 LRYRDVLRPNHYLLLSAKYSLCQIYGRTEGYLLPQMSPEDIARKESY---------CREFLEIV 449
            :.|..:|.      :|..| .||:...    ::|.:|...:.:||..         |..|:..|
 Worm   358 MTYERILP------MSNAY-FCQLIAA----MIPLISRVSMTKKERLVASLDLHLKCETFVRYV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
set-30NP_508850.2 zf-MYND 41..78 CDD:366792
SET_SMYD <179..266 CDD:380997 23/99 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2203
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.