DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and Tinagl1

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_446034.1 Gene:Tinagl1 / 94174 RGDID:70956 Length:467 Species:Rattus norvegicus


Alignment Length:309 Identity:68/309 - (22%)
Similarity:104/309 - (33%) Gaps:128/309 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLLLLLA--VILP------QRQLLPFV-------SGGS-CREAQLCCNGRDSSCVVQKAPINA 49
            :.|||||||  ..|.      :|:|.|.:       :||. |:|..:||.||...|.:       
  Rat     6 LGLLLLLLAGQAALEARRSRWRRELAPGLHLRGIRDAGGRYCQEQDMCCRGRADECAL------- 63

  Fly    50 IIEDLSDKPCYCDHACLK-LGDCCDDFKDHC--------GVLDCQ--------VGDWGAWSECDR 97
               ......||||..|.: :.|||.||.|.|        .|..|.        .|.:  |..|:|
  Rat    64 ---PYLGATCYCDLFCNRTVSDCCPDFWDFCLGIPPPFPPVQGCMHAGRIYPIFGTY--WENCNR 123

  Fly    98 SCGTGMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYRCHGHHDKKILREMALLLPA---ALTHNH 159
                                            |   .||.....:..:|..|:.||   |:...:
  Rat   124 --------------------------------C---TCHEKGQWECDQEPCLVDPAMIKAINRGN 153

  Fly   160 HVNESGD------------LRHNLRTRYRDTYKHNHDQEYCV--EFEVIKSS-KACNKLPPYNLM 209
            :..::|:            :|:.|.|....:...|.::.|.|  :.||:.:: :|..|.|  ||:
  Rat   154 YGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMNEIYTVLGQGEVLPTAFEASEKWP--NLI 216

  Fly   210 TE-------------------GDRITVRCDLEALIQDSAGSSTTARTPQ 239
            .|                   .||:::.         |.|..|...:||
  Rat   217 HEPLDQGNCAGSWAFSTAAVASDRVSIH---------SLGHMTPILSPQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 11/26 (42%)
TSP1 86..136 CDD:214559 5/49 (10%)
Tinagl1NP_446034.1 Somatomedin_B 53..93 CDD:279385 17/49 (35%)
VWC 104..>152 CDD:302663 13/84 (15%)
Peptidase_C1A_CathepsinB 203..455 CDD:239111 13/65 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.