DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and si:dkey-7k24.5

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_001336290.2 Gene:si:dkey-7k24.5 / 796009 ZFINID:ZDB-GENE-131127-626 Length:280 Species:Danio rerio


Alignment Length:229 Identity:69/229 - (30%)
Similarity:104/229 - (45%) Gaps:42/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLLAVILPQRQLLPFVSGGSCREAQLCCNGRDSSCVVQKAPINAIIEDLSDKPCYCDHACLKLG 69
            |.||..::.|       |.|.|::..:||.|::.||:.:...     :|.|...||||.||....
Zfish    29 LALLVTLVSQ-------SEGGCQDTGMCCIGQNQSCISEDWR-----KDRSFGECYCDQACKTTL 81

  Fly    70 DCCDDFKDHCGVLDCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYR 134
            |||.|:...|..:.|.|.:|..||.|...|...:.:|.||::|.|:|||:.||:|||...|..| 
Zfish    82 DCCHDYDLACPAVSCVVSEWSLWSGCLEPCKPTLRSRRRQVIQEARNGGEPCPSLQQTAGCAEY- 145

  Fly   135 CHGHHDKKILREMALLLPAALTHNHHVN--ESGDLRHNLRTRYRDTYKHNHDQEYCVEFEVIKSS 197
             |..|...    :..|:||.:|...:.|  :..::..|:             ..||||||:...:
Zfish   146 -HDQHGPC----LQSLVPALITTGGYGNARKKREVLDNI-------------TGYCVEFELTSLT 192

  Fly   198 KACNKLPPYNLMT-------EGDRITVRCDLEAL 224
            ..|.:  .::..|       ||.::.|.|...||
Zfish   193 AGCQR--SFSSHTRWMRYLKEGHQVCVECQPPAL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 12/25 (48%)
TSP1 86..136 CDD:214559 21/49 (43%)
si:dkey-7k24.5XP_001336290.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4866
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D390796at33208
OrthoFinder 1 1.000 - - FOG0003374
OrthoInspector 1 1.000 - - oto40331
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2727
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.