powered by:
Protein Alignment CG42339 and spon2
DIOPT Version :9
Sequence 1: | NP_572674.3 |
Gene: | CG42339 / 32033 |
FlyBaseID: | FBgn0259241 |
Length: | 395 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031757621.1 |
Gene: | spon2 / 780015 |
XenbaseID: | XB-GENE-945214 |
Length: | 345 |
Species: | Xenopus tropicalis |
Alignment Length: | 55 |
Identity: | 22/55 - (40%) |
Similarity: | 28/55 - (50%) |
Gaps: | 1/55 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 LDCQVGDWGAWSECDRSCGT-GMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYRC 135
|||:|..|.:|..|..|||| |:.:|.|.|.....|.|..||.|.:.:.|....|
Frog 290 LDCEVSVWSSWGLCRGSCGTAGVKSRTRYIRLKPANNGTACPALNEDKECDPENC 344
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.