DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and spon2

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_031757621.1 Gene:spon2 / 780015 XenbaseID:XB-GENE-945214 Length:345 Species:Xenopus tropicalis


Alignment Length:55 Identity:22/55 - (40%)
Similarity:28/55 - (50%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LDCQVGDWGAWSECDRSCGT-GMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYRC 135
            |||:|..|.:|..|..|||| |:.:|.|.|.....|.|..||.|.:.:.|....|
 Frog   290 LDCEVSVWSSWGLCRGSCGTAGVKSRTRYIRLKPANNGTACPALNEDKECDPENC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385
TSP1 86..136 CDD:214559 19/51 (37%)
spon2XP_031757621.1 Spond_N 57..244 CDD:399462
TSP1_spondin 292..344 CDD:408798 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.