| Sequence 1: | NP_572674.3 | Gene: | CG42339 / 32033 | FlyBaseID: | FBgn0259241 | Length: | 395 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_002561.1 | Gene: | PCSK6 / 5046 | HGNCID: | 8569 | Length: | 969 | Species: | Homo sapiens |
| Alignment Length: | 234 | Identity: | 48/234 - (20%) |
|---|---|---|---|
| Similarity: | 70/234 - (29%) | Gaps: | 92/234 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 25 SCREAQLCCNGR-------DSSCVVQKAPINAIIEDLSDKPCY-CDHACLKLGDCCDDFKDHCGV 81
Fly 82 L-------------DCQVGDWG-----AWSECDRSCGTGMMTRNRQILQAAQNGGKH-------C 121
Fly 122 ---------PTLQQK---------RSCQG-----YRCHGHHDKKILREMALLLPAALTHNHHVNE 163
Fly 164 SGDLRHNLRTRYRDTYKHNHDQEYCVEFEVIKSSKACNK 202 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42339 | NP_572674.3 | Somatomedin_B | <53..79 | CDD:279385 | 9/26 (35%) |
| TSP1 | 86..136 | CDD:214559 | 17/84 (20%) | ||
| PCSK6 | NP_002561.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..39 | ||
| S8_pro-domain | 73..149 | CDD:293079 | |||
| Peptidases_S8_Protein_convertases_Kexins_Fur in-like | 160..454 | CDD:173789 | |||
| Peptidase_S8 | 196..479 | CDD:278510 | |||
| P_proprotein | 539..629 | CDD:279782 | |||
| Cell attachment site. /evidence=ECO:0000255 | 553..555 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 658..683 | ||||
| FU 1 | 692..739 | ||||
| CRM (Cys-rich motif) | 695..930 | 39/186 (21%) | |||
| FU | 695..747 | CDD:238021 | |||
| FU | 743..789 | CDD:214589 | 7/32 (22%) | ||
| Furin-like_2 | 751..847 | CDD:292535 | 21/94 (22%) | ||
| FU | 799..845 | CDD:238021 | 10/49 (20%) | ||
| FU | 844..886 | CDD:214589 | 9/41 (22%) | ||
| FU 5 | 895..943 | 11/75 (15%) | |||
| FU | 896..930 | CDD:214589 | 7/42 (17%) | ||
| PLAC | 942..965 | CDD:285849 | 5/16 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||