DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and Rspo2

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_008763676.2 Gene:Rspo2 / 500863 RGDID:1562331 Length:250 Species:Rattus norvegicus


Alignment Length:144 Identity:38/144 - (26%)
Similarity:57/144 - (39%) Gaps:28/144 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QRQLLPFVSGGSCREAQLCCNGRDSSCVVQKAP-----INAIIEDLSDKPCYCDHACLKL----- 68
            |::|..|:.....|:...|.:...|.....:||     ....||:...  |:....|.|.     
  Rat    63 QQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDS--CFSKDFCTKCKAGFY 125

  Fly    69 ---GDCCDDFKDHCGVLD--------CQVGDWGAWSEC---DRSCG--TGMMTRNRQILQAAQNG 117
               |.|.|:..:....||        |:||.|..|..|   :|:||  .|:.||.|||::.....
  Rat   126 LHRGRCFDECPEGFAPLDETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPAKD 190

  Fly   118 GKHCPTLQQKRSCQ 131
            ...|||:.:.|.|:
  Rat   191 TIPCPTIAESRRCK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 6/33 (18%)
TSP1 86..136 CDD:214559 19/51 (37%)
Rspo2XP_008763676.2 Furin-like_2 47..148 CDD:406362 18/86 (21%)
TSP1_spondin 152..205 CDD:408798 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.