DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and Rspo3

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001094460.1 Gene:Rspo3 / 498997 RGDID:1563246 Length:276 Species:Rattus norvegicus


Alignment Length:186 Identity:49/186 - (26%)
Similarity:71/186 - (38%) Gaps:58/186 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QRQLLPFVSGGSCREAQLCCNGRDS--SC------VVQKAPINAIIEDLSDKP------------ 58
            ||::.|.||.| |:.....|:..:.  ||      |:::..:..|...||..|            
  Rat    30 QRRMHPNVSQG-CQGGCATCSDYNGCLSCKPRLFFVLERIGMKQIGVCLSSCPSGYYGTRYPDIN 93

  Fly    59 -----------CYCDHACLK--------LGDCCD------DFKDH---C-GVLDCQVGDWGAWSE 94
                       |:..:.|.|        ||.|.|      :..:|   | .::.|:..||.:||.
  Rat    94 KCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDSCPEGLEASNHTMECVSIVHCEASDWSSWSP 158

  Fly    95 C---DRSCG--TGMMTRNRQILQAAQNGGKHCPTLQQKRSC--QGYRC-HGHHDKK 142
            |   .::||  .|..||.|.|||.....|..||...:.|:|  |..:| .|...||
  Rat   159 CMKKGKTCGFKRGTETRVRDILQHPSAKGNLCPPTSETRTCIVQRKKCSKGERGKK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 11/65 (17%)
TSP1 86..136 CDD:214559 21/57 (37%)
Rspo3NP_001094460.1 Furin-like_2 42..144 CDD:292535 17/101 (17%)
FU 97..143 CDD:238021 8/45 (18%)
TSP1 151..202 CDD:214559 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.