DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42339 and mspo

DIOPT Version :9

Sequence 1:	NP_572674.3	Gene:	CG42339 / 32033	FlyBaseID:	FBgn0259241	Length:	395	Species:	Drosophila melanogaster
Sequence 2:	NP_001286427.1	Gene:	mspo / 36632	FlyBaseID:	FBgn0020269	Length:	601	Species:	Drosophila melanogaster

Alignment Length:	56	Identity:	25/56 - (44%)
Similarity:	35/56 - (62%)	Gaps:	1/56 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    83 DCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYR-CHG 137
            ||:|..|..|:.|.:|||.|.|.|.|::::..:.||:.||.|||.:.|...| |||
  Fly   534 DCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCGTERNCHG 589

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42339	NP_572674.3	Somatomedin_B	<53..79	CDD:279385
CG42339	NP_572674.3	TSP1	86..136	CDD:214559	20/50 (40%)
mspo	NP_001286427.1	Spond_N	120..363	CDD:283999
mspo	NP_001286427.1	TSP1	537..588	CDD:214559	20/50 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3539
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.810