DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and CG17739

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_610757.1 Gene:CG17739 / 36333 FlyBaseID:FBgn0033710 Length:873 Species:Drosophila melanogaster


Alignment Length:162 Identity:45/162 - (27%)
Similarity:62/162 - (38%) Gaps:62/162 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CREAQL-----CCNGRDSSCVVQKAPINAII-----EDLSDKPC---------YCDH----ACLK 67
            ||..:|     |.|   .||       :.|:     ::|:|.||         |.||    ..:.
  Fly   638 CRHIKLHEEVNCTN---PSC-------DTIVPGFCYDELTDSPCRDNDVANFWYYDHVSDQCAIY 692

  Fly    68 LGDCCD----DFK------------------DHCGV--LDCQVGDWGAWSECDRSCGTGMMTRNR 108
            ..|.||    .||                  .|.|:  :||.|.||.:.| |:.|||.|...|.|
  Fly   693 WSDRCDTNRNKFKSKEECEETCRLPRHKQELQHDGIPAIDCLVSDWVSHS-CNASCGDGFQLRTR 756

  Fly   109 QILQAAQNGGKHCPTLQQKRSCQGYRCHGHHD 140
            ::|:..:.|||.||    |...:..||:...|
  Fly   757 RVLRTPKYGGKPCP----KHLVRLDRCYQRCD 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 12/60 (20%)
TSP1 86..136 CDD:214559 19/49 (39%)
CG17739NP_610757.1 Reeler 23..163 CDD:260081
Spond_N 186..373 CDD:283999
TSP1 412..460 CDD:214559
TSP1 490..541 CDD:214559
KU 661..715 CDD:294074 12/53 (23%)
TSP_1 815..862 CDD:278517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.