DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and RSPO4

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_016883328.1 Gene:RSPO4 / 343637 HGNCID:16175 Length:266 Species:Homo sapiens


Alignment Length:196 Identity:48/196 - (24%)
Similarity:76/196 - (38%) Gaps:61/196 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLLL------LLAVILPQRQLLPFVSGGSCREAQLCC--NGRDSSC------VVQKAPINAII 51
            :.||||      :||:...::|:...: ||:|....:|.  || .|:|      .:::..|....
Human     5 LCLLLLVAHAVDMLALNRRKKQVGTGL-GGNCTGCIICSEENG-CSTCQQRLFLFIRREGIRQYG 67

  Fly    52 EDLSD-KPCYCD------HACLKLGDCCDD----------------FKDHC------GVL----- 82
            :.|.| .|.|..      :.|.|.|..|:.                :|..|      |.|     
Human    68 KCLHDCPPGYFGIRGQEVNRCKKCGATCESCFSQDFCIRCKRQFYLYKGKCLPTCPPGTLAHQNT 132

  Fly    83 -----DCQVGDWGAWSEC---DRSCGT--GMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYR-CH 136
                 :|::|.||.||.|   .::||:  |:.:|.|:..:|.......|..|.:.|.|...| |.
Human   133 RECQGECELGPWGGWSPCTHNGKTCGSAWGLESRVREAGRAGHEEAATCQVLSESRKCPIQRPCP 197

  Fly   137 G 137
            |
Human   198 G 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 9/48 (19%)
TSP1 86..136 CDD:214559 17/55 (31%)
RSPO4XP_016883328.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.