powered by:
Protein Alignment CG42339 and spon2a
DIOPT Version :9
Sequence 1: | NP_572674.3 |
Gene: | CG42339 / 32033 |
FlyBaseID: | FBgn0259241 |
Length: | 395 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571082.1 |
Gene: | spon2a / 30201 |
ZFINID: | ZDB-GENE-990415-160 |
Length: | 334 |
Species: | Danio rerio |
Alignment Length: | 55 |
Identity: | 20/55 - (36%) |
Similarity: | 27/55 - (49%) |
Gaps: | 1/55 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 LDCQVGDWGAWSECDRSCGT-GMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYRC 135
|||:|..|.:|..|...|.. |:..|.|.||....|.|..||.|:::..|..:.|
Zfish 276 LDCEVSMWSSWGLCFGPCARGGLRHRTRYILLKPANSGSPCPELEEQEECTPHNC 330
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3539 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.