DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and spon2a

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_571082.1 Gene:spon2a / 30201 ZFINID:ZDB-GENE-990415-160 Length:334 Species:Danio rerio


Alignment Length:55 Identity:20/55 - (36%)
Similarity:27/55 - (49%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LDCQVGDWGAWSECDRSCGT-GMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYRC 135
            |||:|..|.:|..|...|.. |:..|.|.||....|.|..||.|:::..|..:.|
Zfish   276 LDCEVSMWSSWGLCFGPCARGGLRHRTRYILLKPANSGSPCPELEEQEECTPHNC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385
TSP1 86..136 CDD:214559 17/51 (33%)
spon2aNP_571082.1 Spond_N 44..230 CDD:283999
TSP1 283..330 CDD:214559 15/46 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.