DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42339 and Spon1

DIOPT Version :9

Sequence 1:	NP_572674.3	Gene:	CG42339 / 32033	FlyBaseID:	FBgn0259241	Length:	395	Species:	Drosophila melanogaster
Sequence 2:	NP_663559.1	Gene:	Spon1 / 233744	MGIID:	2385287	Length:	807	Species:	Mus musculus

Alignment Length:	75	Identity:	29/75 - (38%)
Similarity:	44/75 - (58%)	Gaps:	6/75 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    67 KLGDCCDDFK--DHCGV----LDCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHCPTLQ 125
            :||||.:|.:  :.|.:    :||::.:|..||||::|||.|.|.|.|.|....|.||..||...
Mouse   646 ELGDCNEDLEQAEKCMLPECPIDCELSEWSQWSECNKSCGKGHMIRTRTIQMEPQFGGVPCPETV 710

  Fly   126 QKRSCQGYRC 135
            |::.|:..:|
Mouse   711 QRKKCRTRKC 720

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42339	NP_572674.3	Somatomedin_B	<53..79	CDD:279385	5/13 (38%)
CG42339	NP_572674.3	TSP1	86..136	CDD:214559	21/50 (42%)
Spon1	NP_663559.1	Reeler	43..182	CDD:260081
		Spond_N	205..392	CDD:283999
		TSP_1	446..494	CDD:278517
		TSP_1	505..554	CDD:278517
		TSP_1	562..610	CDD:278517
		TSP_1	618..665	CDD:278517	6/18 (33%)
		TSP_1	672..720	CDD:278517	20/47 (43%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	732..752
		TSP_1	758..807	CDD:278517
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	54	1.000	Domainoid score	I11213
eggNOG	1	0.900	-	-		E1_KOG3539
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.810