DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and Rspo4

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001035779.1 Gene:Rspo4 / 228770 MGIID:1924467 Length:228 Species:Mus musculus


Alignment Length:198 Identity:46/198 - (23%)
Similarity:72/198 - (36%) Gaps:60/198 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLLLA------VILPQRQLLPFVSGGSCREAQLCC--NGRDSSC------VVQKAPINAIIEDL 54
            ||||||      .:..:::......||:|....:|.  || .|:|      .:::..|....:.:
Mouse     7 LLLLLAHAVDMLALYRRKKQAGTGLGGNCTGCVICSEENG-CSTCQQRLFLFIRREGIRQYGKCV 70

  Fly    55 SDKPC-------YCDHACLKLGDCCDD----------------FKDHC------GVL-------- 82
            .|.|.       ...:.|.|.|..|:.                :|..|      |.|        
Mouse    71 HDCPLGFFGIRGQEANRCKKCGATCESCFSQDFCIRCKRRFHLYKGKCLPSCPPGTLTHQSTREC 135

  Fly    83 --DCQVGDWGAWSEC---DRSCGT--GMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYR-CHGHH 139
              :|:...||:||.|   .::||:  |:.||.|:...|.|.....|..|.:.|.|...| |.|..
Mouse   136 QEECEPSPWGSWSPCIHNGKTCGSGWGLETRVREAGPAKQEETASCRVLSESRKCPIKRLCPGER 200

  Fly   140 DKK 142
            :.:
Mouse   201 NPR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 7/48 (15%)
TSP1 86..136 CDD:214559 18/55 (33%)
Rspo4NP_001035779.1 Furin-like_2 35..138 CDD:292535 17/103 (17%)
FU 85..128 7/42 (17%)
FU 85..126 CDD:214589 6/40 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..228 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.