DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and Sbspon

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001028460.1 Gene:Sbspon / 226866 MGIID:2684952 Length:264 Species:Mus musculus


Alignment Length:407 Identity:85/407 - (20%)
Similarity:124/407 - (30%) Gaps:155/407 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLLLLLAVILPQRQLLPFVSGGSCREAQLCCNGRDSSCVVQKAPINAIIEDLSDKPCYCDHAC 65
            |..|.::|..:   .:|.|....| |.||..||.|||.:|..:...::.:.     ..|:||.||
Mouse     1 MKTLWMVLCAL---ARLWPGALAG-CAEAGRCCPGRDPACFARGWRLDRVY-----GTCFCDQAC 56

  Fly    66 LKLGDCCDDFKDHCGVLDCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHCPTLQQKRSC 130
            ...||||.|:...|....|.||:|..||.|...|......|.|.:.|...|||..||.|:::..|
Mouse    57 RLTGDCCFDYDRACPARPCFVGEWSPWSGCAGQCQPTTRVRRRSVRQEPLNGGAPCPPLEERAGC 121

  Fly   131 ------QGYRCHGHHDKKILREMALLLPAALTHNHHVNESGDLRHNLRTRYRDTYKHNHDQEYCV 189
                  |...| ||.          .:||.:|     :...:.:..::........|..|..||:
Mouse   122 LEYSSSQSQDC-GHS----------FVPAFIT-----SSVFNKKRIIQAVSPQWSTHTKDAGYCM 170

  Fly   190 EFEVIKSSKAC----NKLPPY-NLMTEGDRITVRCDLEALIQDSAGSSTTARTPQGPTTPSTTTV 249
            ||:....:..|    :.|..: ..:.||..:.|.|.                      .|:..:|
Mouse   171 EFKTESLTPHCALVNSPLTRWMQYLREGYTVCVDCQ----------------------PPAMNSV 213

  Fly   250 SSAASAFGQRTDDLEEERLQRETSSEEEATNQDGEAEEEDEEPEQDEQDDLQNALDSDSNESTDY 314
            |...|..|                                              ||||.|:    
Mouse   214 SLRCSGDG----------------------------------------------LDSDGNQ---- 228

  Fly   315 RHQRQSQMSQMSHSRRTAGKRSAVPATPSPTLPPTYHCRGEGLAGRTTRWSALPAPSCRGKWLRL 379
                                                          |.||.|:..|.|:|.|.::
Mouse   229 ----------------------------------------------TLRWQAIGNPRCQGTWKKV 247

  Fly   380 TVGPPKKCGHA-QFIFV 395
            .......|... :|||:
Mouse   248 RRVEQCSCPDVHRFIFI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 10/25 (40%)
TSP1 86..136 CDD:214559 18/55 (33%)
SbsponNP_001028460.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4766
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003374
OrthoInspector 1 1.000 - - oto94361
orthoMCL 1 0.900 - - OOG6_106929
Panther 1 1.100 - - O PTHR20920
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3505
SonicParanoid 1 1.000 - - X2727
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.