DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and sbsp-1

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_499387.1 Gene:sbsp-1 / 176513 WormBaseID:WBGene00011269 Length:440 Species:Caenorhabditis elegans


Alignment Length:186 Identity:53/186 - (28%)
Similarity:81/186 - (43%) Gaps:28/186 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CYCDHACLKLGDCCDDFKDHCGVLDCQVGDWGAWSEC---DRSCGTGMMTRNRQILQAAQNGGKH 120
            ||||..|:.|||||.|:...|...||.:.||.:|::|   :.:||.|...|.|.::|.|:.||..
 Worm   219 CYCDEHCVTLGDCCSDYTFVC
PPRDCVLTDWDSWTQCTADNGTCGIGTQKRLRHVIQHAERGGAA 283

  Fly   121 CPTLQQKRSCQGYRCHGHHDKKILREMALLLPAALTHNHHVNESGDLRHNLRTRYRD-------- 177
            |..|::.|:| ...|   ..||...:....:...|.:.|:...|...|:|:   |.|        
 Worm   284 CEPLKEMRTC-FVEC---RPKKSALDDITTVALILDYRHNKTRSKIRRNNI---YWDLPNVAEKM 341

  Fly   178 ---TYKHNHDQEYCVEFEVIKSSKACNKLPPYNLMTEGDRITVRCDLEALIQDSAG 230
               ||       |||.:.:...::.|........::||..:...|..||....:.|
 Worm   342 KKATY-------YCVHYTIDWVNRNCVSRLLNKGLSEGSVMCAECQPEATYHRNNG 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 11/19 (58%)
TSP1 86..136 CDD:214559 17/52 (33%)
sbsp-1NP_499387.1 Somatomedin_B <213..239 CDD:366428 11/19 (58%)
TSP1 247..296 CDD:214559 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I3448
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003374
OrthoInspector 1 1.000 - - oto20147
orthoMCL 1 0.900 - - OOG6_106929
Panther 1 1.100 - - LDO PTHR20920
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3505
SonicParanoid 1 1.000 - - X2727
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.