DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and spon-1

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_495473.2 Gene:spon-1 / 174169 WormBaseID:WBGene00006893 Length:819 Species:Caenorhabditis elegans


Alignment Length:117 Identity:34/117 - (29%)
Similarity:52/117 - (44%) Gaps:21/117 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FVSGGSCREAQLCCNGRDSSCVVQKAPINAIIEDLSDKPCYCDHACLKLGDCCDDFKDHCGVLDC 84
            |.:...|:  |:|..|.:.|  ....|.|.::||..:..             .||..:.   :||
 Worm   662 FETEEECK--QICLPGYEKS--KSLIPNNQLLEDFGNTE-------------VDDGGER---VDC 706

  Fly    85 QVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHCPT-LQQKRSCQGYRC 135
            :|..|.||..|..|||.|..:|:|.:::.|:|||..|.. |.|:..|:...|
 Worm   707 EVSKWTAWGSCSVSCGRGKKSRSRHVVKLARNGGHQCSEHLMQELQCRLRPC 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 3/25 (12%)
TSP1 86..136 CDD:214559 20/51 (39%)
spon-1NP_495473.2 Reeler 36..171 CDD:260081
Spond_N 197..381 CDD:283999
TSP1 435..481 CDD:214559
TSP1 499..551 CDD:214559
TSP1 562..610 CDD:214559
Kunitz_BPTI 621..672 CDD:278443 3/11 (27%)
TSP1 708..759 CDD:214559 20/51 (39%)
TSP1 766..816 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.