powered by:
Protein Alignment CG42339 and Spon2
DIOPT Version :9
Sequence 1: | NP_572674.3 |
Gene: | CG42339 / 32033 |
FlyBaseID: | FBgn0259241 |
Length: | 395 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_612542.1 |
Gene: | Spon2 / 171569 |
RGDID: | 708584 |
Length: | 330 |
Species: | Rattus norvegicus |
Alignment Length: | 55 |
Identity: | 19/55 - (34%) |
Similarity: | 26/55 - (47%) |
Gaps: | 1/55 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 LDCQVGDWGAWSECDRSCG-TGMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYRC 135
|||:|..|.:|..|...|| .|..:|.|.:.....|.|..||.|:::..|....|
Rat 275 LDCEVSLWSSWGLCGGPCGKLGAKSRTRYVRVQPANNGTPCPELEEEAECAPDNC 329
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3539 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.