DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and Spon2

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_612542.1 Gene:Spon2 / 171569 RGDID:708584 Length:330 Species:Rattus norvegicus


Alignment Length:55 Identity:19/55 - (34%)
Similarity:26/55 - (47%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LDCQVGDWGAWSECDRSCG-TGMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYRC 135
            |||:|..|.:|..|...|| .|..:|.|.:.....|.|..||.|:::..|....|
  Rat   275 LDCEVSLWSSWGLCGGPCGKLGAKSRTRYVRVQPANNGTPCPELEEEAECAPDNC 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385
TSP1 86..136 CDD:214559 16/51 (31%)
Spon2NP_612542.1 Spond_N 40..227 CDD:283999
TSP1 279..329 CDD:214559 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.