DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and SBSPON

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_694957.3 Gene:SBSPON / 157869 HGNCID:30362 Length:264 Species:Homo sapiens


Alignment Length:397 Identity:89/397 - (22%)
Similarity:121/397 - (30%) Gaps:162/397 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QLLPFVSGGSCREAQLCCNGRDSSCVVQKAPINAIIEDLSDKPCYCDHACLKLGDCCDDFKDHCG 80
            :|.|....| |.||..||.|||.:|..:...::.:.     ..|:||.||...||||.|:...|.
Human    13 RLWPGAQAG-CAEAGRCCPGRDPACFARGWRLDRVY-----GTCFCDQACRFTGDCCFDYDRACP 71

  Fly    81 VLDCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHCPTLQQKRSC------QGYRCHGHH 139
            ...|.||:|..||.|...|......|.|.:.|..||||..||.|:::..|      ||..| || 
Human    72 ARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAGCLEYSTPQGQDC-GH- 134

  Fly   140 DKKILREMALLLPAALTHNHHVNESGDLRHNLRTRYRDT---YKHNHDQEYCVEFEVIKSSKACN 201
                     ..:||.:|.:....|        |||...:   ..|..|..||:||:....:..| 
Human   135 ---------TYVPAFITTSAFNKE--------RTRQATSPHWSTHTEDAGYCMEFKTESLTPHC- 181

  Fly   202 KLPPYNL------MTEGDRITVRCDLEALIQDSAGSSTTARTPQGPTTPSTTTVSSAASAFGQRT 260
            .|..:.|      :.||..:.|.|.                      .|:..:||...|..|   
Human   182 ALENWPLTRWMQYLREGYTVCVDCQ----------------------PPAMNSVSLRCSGDG--- 221

  Fly   261 DDLEEERLQRETSSEEEATNQDGEAEEEDEEPEQDEQDDLQNALDSDSNESTDYRHQRQSQMSQM 325
                                                       ||||.|:               
Human   222 -------------------------------------------LDSDGNQ--------------- 228

  Fly   326 SHSRRTAGKRSAVPATPSPTLPPTYHCRGEGLAGRTTRWSALPAPSCRGKWLRLTVGPPKKCG-- 388
                                               |..|.|:..|.|:|.|.::.......|.  
Human   229 -----------------------------------TLHWQAIGNPRCQGTWKKVRRVDQCSCPAV 258

  Fly   389 HAQFIFV 395
            |: |||:
Human   259 HS-FIFI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 10/25 (40%)
TSP1 86..136 CDD:214559 20/55 (36%)
SBSPONNP_694957.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144338
Domainoid 1 1.000 48 1.000 Domainoid score I11971
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4746
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D390796at33208
OrthoFinder 1 1.000 - - FOG0003374
OrthoInspector 1 1.000 - - oto90778
orthoMCL 1 0.900 - - OOG6_106929
Panther 1 1.100 - - O PTHR20920
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3505
SonicParanoid 1 1.000 - - X2727
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.