DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and AgaP_AGAP012307

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_320234.3 Gene:AgaP_AGAP012307 / 1280387 VectorBaseID:AGAP012307 Length:860 Species:Anopheles gambiae


Alignment Length:252 Identity:50/252 - (19%)
Similarity:79/252 - (31%) Gaps:101/252 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CCNGRDSSCVVQKAPINAIIEDLSDK-----PCY-----CDHACLKLGDCCDDFKDHCGVLDCQV 86
            |..|:.:...:.|.|:.|...:...|     ||.     ||:...::.:......      :|:|
Mosquito   423 CGKGKQTRRRIYKHPMKAKQAECKKKLFDRRPCVGTDRDCDYNSQEIEEAYQSDP------ECEV 481

  Fly    87 GDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHC------PTLQQKRSCQGYRCHGHHDKKIL- 144
            .:||.||||...||.|..||:|:..:  :...|.|      |.|||...|. ..|.|...:.:| 
Mosquito   482 TEWGPWSECSSPCGKGNKTRSRKYKK--KGARKKCERLPNPPMLQQTVPCD-EDCGGDISQPVLS 543

  Fly   145 ------------------------------------------------------REMALLLPAAL 155
                                                                  |:|...:|   
Mosquito   544 SDVTIKTMAGGEGLCDANPSSSSSLACRLLQINPKCKMTQWSEWSPCSVTCGLGRKMRTRMP--- 605

  Fly   156 THNHHVNESGDLRHNLRTRYR------DTYKHNHDQ-EYCVEFEVIKSSKACNKLPP 205
                 :|:|      :||.::      |...|..|| :.|...|.::.....:.|||
Mosquito   606 -----INKS------MRTHHKRFDMGDDNDLHITDQNDPCYGVETVEEVTCGHDLPP 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 5/35 (14%)
TSP1 86..136 CDD:214559 20/55 (36%)
AgaP_AGAP012307XP_320234.3 Reeler 24..151 CDD:280232
Spond_N 184..371 CDD:283999
TSP1 412..455 CDD:214559 6/31 (19%)
TSP1 481..532 CDD:214559 20/53 (38%)
TSP1 581..>607 CDD:214559 3/33 (9%)
Kunitz_BPTI 662..712 CDD:278443
TSP1 734..781 CDD:214559
TSP1 809..856 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.