DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and AgaP_AGAP012813

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_306815.3 Gene:AgaP_AGAP012813 / 1268257 VectorBaseID:AGAP012813 Length:138 Species:Anopheles gambiae


Alignment Length:120 Identity:26/120 - (21%)
Similarity:42/120 - (35%) Gaps:31/120 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYRCHGHHDKKILREM 147
            ||:...|.. ..|:.:||.|...::|.||....|||:.||...:|..    ||..|.|..     
Mosquito    43 DCKTSHWKR-GPCNATCGEGFRVKSRTILVHPSNGGQRCPRKLRKVE----RCFVHCDSS----- 97

  Fly   148 ALLLPAALTHNHHVNESGDLRHNLRTRYRDTYKHNHDQEYCVEFEVIKSSKACNK 202
                                ||:....:..:.::..:...| |:....:...|:|
Mosquito    98 --------------------RHDTNPSWGPSTRYEPEPIEC-EYSAWSAWSPCSK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385
TSP1 86..136 CDD:214559 15/49 (31%)
AgaP_AGAP012813XP_306815.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.