DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and LOC100492479

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002931935.2 Gene:LOC100492479 / 100492479 -ID:- Length:255 Species:Xenopus tropicalis


Alignment Length:381 Identity:88/381 - (23%)
Similarity:122/381 - (32%) Gaps:151/381 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VSGG--SC--REAQLCCNGRDSSCVVQKAPINAIIEDLSDKPCYCDHACLKLGDCCDDFKDHCG- 80
            :.||  :|  |....||.||:::|.   ||      ..:...||||..|.:.||||.|::..|| 
 Frog    20 IPGGRSACARRAHPKCCPGRNNACT---AP------SRTGPTCYCDSYCTRSGDCCQDYRSQCGG 75

  Fly    81 -VLDCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHCPTLQQKRSCQGYRCHGHHDKKIL 144
             |..|.||.||:||||...||.|...|.||::....:||..||.|:|:..|.|    |..|..:.
 Frog    76 SVSHCVVGPWGSWSECSSRCGIGSRERTRQVVVPPSSGGSPCPDLRQRCGCYG----GDPDCHMS 136

  Fly   145 REMALLLPAALTHNHHVNESGDLRHNLRTRYRDTYKHNHDQEYCVEFEVIKSSKACNKLPPYNLM 209
            .::|.:||.:...        |.|...| ||..|.: .....|||.|.:......|........:
 Frog   137 TDVAKILPDSFKR--------DFRDPWR-RYLTTVQ-ERAPSYCVYFRLKHVGLGCQLQGWSRQL 191

  Fly   210 TEGDRITVRCDLEALIQDSAGSSTTARTPQGPTTPSTTTVSSAASAFGQRTDDLEEERLQRETSS 274
            .....:.|.|..||     |||:                                          
 Frog   192 IREQLVCVECQKEA-----AGSN------------------------------------------ 209

  Fly   275 EEEATNQDGEAEEEDEEPEQDEQDDLQNALDSDSNESTDYRHQRQSQMSQMSHSRRTAGKRSAVP 339
                                                                      |:     
 Frog   210 ----------------------------------------------------------GR----- 211

  Fly   340 ATPSPTLPPTYHCRGEGLAGRTTRWSALPAPSCRGKWLRLTVGPPKKCGHAQFIFV 395
                        |:|:||||..|.|:|....||:|.|::..:.....|....|:||
 Frog   212 ------------CQGDGLAGVRTFWAAASLSSCQGSWVQEDLREHCTCKLVSFLFV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 10/25 (40%)
TSP1 86..136 CDD:214559 22/49 (45%)
LOC100492479XP_002931935.2 Somatomedin_B <47..75 CDD:366428 11/27 (41%)
TSP1 82..>123 CDD:214559 19/40 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4835
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D390796at33208
OrthoFinder 1 1.000 - - FOG0003374
OrthoInspector 1 1.000 - - otm48990
Panther 1 1.100 - - LDO PTHR20920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2727
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.