DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and sbspon

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002937118.2 Gene:sbspon / 100489582 XenbaseID:XB-GENE-6463898 Length:269 Species:Xenopus tropicalis


Alignment Length:237 Identity:73/237 - (30%)
Similarity:101/237 - (42%) Gaps:49/237 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLLLAVILPQRQLLPFVSGGSCREAQLCCNGRDSSCVVQKAPINAIIEDLSDKPCYCDHACLKL 68
            |||.|||::...:       |.|.||..||.|||.:|..|...::.:.     ..|:||.||...
 Frog    14 LLLGLAVLIRSAE-------GGCMEAAKCCRGRDMNCTSQGWRLDRLY-----GTCFCDQACGLT 66

  Fly    69 GDCCDDFKDHCGVLDCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHCPTLQQKRSC--- 130
            ||||.|:...|....|.||:|..||.|...|...:..|.||::|..:|||..||.|::|..|   
 Frog    67 GDCCFDYSQACPARACIVGEWSHWSGCADPCTPALRVRRRQVVQEPENGGDPCPALEEKAGCLEY 131

  Fly   131 ---QGYRCHGHHDKKILREMALLLPAALTHNHHVNESGDLRHNLRTRYRDTYKHN-----HDQEY 187
               ||..|...|           :.|.:|         ...:| ::|.|.....|     .|..|
 Frog   132 FTSQGTECAQSH-----------VTAFIT---------TFEYN-KSRRRRALSPNWATEKEDAGY 175

  Fly   188 CVEFEVIKSSKAC-NKLPPY----NLMTEGDRITVRCDLEAL 224
            ||||:|...|:.| .:..|:    ..:.||..:.|.|...|:
 Frog   176 CVEFQVKSLSQDCLIESRPHARWMQYLREGYTVCVACQHPAM 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 10/25 (40%)
TSP1 86..136 CDD:214559 21/55 (38%)
sbsponXP_002937118.2 TSP1_spondin 82..128 CDD:408798 19/45 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11131
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4835
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D390796at33208
OrthoFinder 1 1.000 - - FOG0003374
OrthoInspector 1 1.000 - - otm48990
Panther 1 1.100 - - O PTHR20920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2727
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.