DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and sbspon

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_001920147.2 Gene:sbspon / 100151218 -ID:- Length:261 Species:Danio rerio


Alignment Length:417 Identity:81/417 - (19%)
Similarity:118/417 - (28%) Gaps:178/417 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLL------LLLLAVILPQRQLLPFVSGGSCREAQLCCNGRDSSCVVQKAPINAIIEDLSDKPC 59
            |.||      |||:|....    :...|.|.|  :..||.|.|.:|......::.:.     ..|
Zfish     1 MGLLSVKQNALLLVATFFG----MCHFSDGGC--SGRCCQGSDFTCFTTDWRMDHVY-----GTC 54

  Fly    60 YCDHACLKLGDCCDDFKDHCGVLDCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKHCPTL 124
            |||..|||..|||.|:...|....|.|.:|..||.|.:.|......|.|.:.:..||.|:.|.:|
Zfish    55 YCDEKCLKTKDCCFDYPAECPAQPCVVSEWSNWSGCAQPCQPSFRVRRRNVERLPQNNGEACLSL 119

  Fly   125 QQKRSCQGYRCHGHHDKKILREMALLLPAALTHNHHVNESGDLRHNLRTRYRDTYKHNHDQEYCV 189
            :::..|..|:.|........:..|.:.....:               :.|..:.|....|..:|:
Zfish   120 EEQAGCMEYQDHQGQFCSQTQGAAFITTMEYS---------------KGRTHELYGAPVDAGFCM 169

  Fly   190 EFEVIKSSKAC---NKLPPY----NLMTEGDRITVRCDLEALIQDSAGSSTTARTPQGPTTPSTT 247
            ||::...:..|   |:  ||    ..:.||..:.|.|.                           
Zfish   170 EFKMESLTAQCMGENR--PYARWMQYLREGYTVCVACQ--------------------------- 205

  Fly   248 TVSSAASAFGQRTDDLEEERLQRETSSEEEATNQDGEAEEEDEEPEQDEQDDLQNALDSDSNEST 312
                                                                             
Zfish   206 ----------------------------------------------------------------- 205

  Fly   313 DYRHQRQSQMSQMSHSRRTAGKRSAVPATPSPTLPPTYH---CRGEG-LAGRT--TRWSALPAPS 371
                                              ||..|   |:|:| ||.|.  ..|.|:..|.
Zfish   206 ----------------------------------PPANHSWGCQGDGNLAERNDLLHWQAVGNPP 236

  Fly   372 CRGKWLRLTVGPPKKCGHAQ---FIFV 395
            |||.|.:  |...:.|...|   |||:
Zfish   237 CRGTWRK--VQRLQHCSCPQVHSFIFI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 11/25 (44%)
TSP1 86..136 CDD:214559 15/49 (31%)
sbsponXP_001920147.2 Somatomedin_B 28..74 CDD:307259 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577413
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4866
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D390796at33208
OrthoFinder 1 1.000 - - FOG0003374
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106929
Panther 1 1.100 - - O PTHR20920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2727
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.