DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42339 and myof.1

DIOPT Version :9

Sequence 1:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_031760540.1 Gene:myof.1 / 100037837 XenbaseID:XB-GENE-5957842 Length:2086 Species:Xenopus tropicalis


Alignment Length:208 Identity:44/208 - (21%)
Similarity:61/208 - (29%) Gaps:76/208 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 DSAGSSTTAR----TPQG-------PTTPSTTTVSSAASAFGQRTDDLEEERLQRETSSEEEATN 280
            |..||....|    .|:|       ...|..:.::.|.:...:.||::          .|.||..
 Frog   888 DVTGSIKLKRESFLPPKGWEWEDDWKVDPERSLLTEADAGHTEFTDEI----------FENEARY 942

  Fly   281 QDGEAEEEDE-------EPEQDEQD----------------DLQNALDSDSNE-----STDYRHQ 317
            ..||.::.||       |......|                |:..|:|.:..|     ..|.:.:
 Frog   943 PGGEWKKADETFTDANGEKSASPSDLSCPFGWIWDDDGWMRDINRAVDENGWEYGLTIPPDSKPK 1007

  Fly   318 RQSQMSQMSHS---RRTAGKRSAVP---ATPSPTLPPTYHCRGEG-----LAG------------ 359
            ......:|.|:   ||...||...|   .|....|.|.   ..||     |.|            
 Frog  1008 SWVAAEKMYHTNRRRRLVRKRKKDPKVSTTSKAALTPQ---EQEGWEYAALIGWKFHITPRSSDT 1069

  Fly   360 -RTTRWSALPAPS 371
             |..||....|||
 Frog  1070 FRRRRWRRKMAPS 1082

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385
TSP1 86..136 CDD:214559
myof.1XP_031760540.1 C2A_Ferlin 5..136 CDD:176019
C2B_Ferlin 195..304 CDD:175978
FerI 302..352 CDD:400459
C2C_Ferlin 358..537 CDD:175985
FerA 681..738 CDD:400471
FerB 769..842 CDD:400458
DysFN 857..915 CDD:214777 6/26 (23%)
DysFN 928..984 CDD:214777 11/65 (17%)
C2D_Ferlin 1136..1267 CDD:175984
C2E_Ferlin 1584..1707 CDD:176002
C2F_Ferlin 1820..1950 CDD:176020
Ferlin_C 1964..2081 CDD:406552
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.