DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C901 and Cd93

DIOPT Version :9

Sequence 1:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_445835.2 Gene:Cd93 / 84398 RGDID:621251 Length:643 Species:Rattus norvegicus


Alignment Length:546 Identity:125/546 - (22%)
Similarity:177/546 - (32%) Gaps:211/546 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YRRNFDARQSSNSNIPLWK--QRACEKSQKQRQNAHYVCDE--KGDFKCLPGWQGDLCQVPMCRR 86
            |...|.|..||...:|...  ...|....:.:.| :|:|.|  .|.|..  |..|.||..|  :.
  Rat   200 YTTPFQATTSSLKAVPFASVANVVCGDEAESKTN-YYLCKETTAGVFHW--GSSGPLCVSP--KF 259

  Fly    87 GCDPMNGYCQRPGECRCRIGYSGELCDKCIPLPGCQHGGCTKPFECICKPGWAGLF--------- 142
            ||...||.||:                      .|..|| ...|.|.|:||:..|.         
  Rat   260 GCSFNNGGCQQ----------------------DCFEGG-DGSFRCGCRPGFRLLDDLVTCASRN 301

  Fly   143 -CTEPSCRTG--CHS---TRGYCEAPGECRCRIGY-AGRTCSECATMPGCQHGTCNKPLECLCLP 200
             |:...|..|  |||   :..|     .|.|..|| ...:...|..:..|:...|::  ||:..|
  Rat   302 PCSSNPCTGGGMCHSVPLSENY-----TCHCPRGYQLDSSQVHCVDIDECEDSPCDQ--ECINTP 359

  Fly   201 GYTGLLCQTPICDPDCSKQHGYCRKPGECRCKVGWTGS--------QCDKC-FPYPGCANG--DC 254
            |                   |:     .|.|.||:..|        ..|:| ..|..||.|  :.
  Rat   360 G-------------------GF-----HCECWVGYQSSGSKEEACEDVDECTAAYSPCAQGCTNT 400

  Fly   255 EAPWECNCHPGWGGMLCDEKLTYCVEHPDTCENGGKCTSLS-REDGSYQCQCRQGF----LGKNC 314
            :..:.|:|..|:  ::..|..|.| |..|.| .|..|.:|. ..|||::|.|..||    .|.:|
  Rat   401 DGSFYCSCKEGY--IMSGEDSTQC-EDIDEC-LGNPCDTLCINTDGSFRCGCPAGFELAPNGVSC 461

  Fly   315 EIRDDFLLTSEAPPRITPPTPAELVLELDGELDQNGQQDIGAGVPDDSEPGGGLVGEKLPAGNEP 379
            .....|   ||.|.|  ||.                ::|.|.|                      
  Rat   462 TRGSMF---SELPAR--PPQ----------------KEDKGDG---------------------- 483

  Fly   380 ERRKNDTVANVATAGTGAGAGPMNSLPGNSNATRTTLVVATETGSDNATNEALSAVTTRRATPIP 444
               |..||             |:..:||:.|            ||.:.:|.|.:.          
  Rat   484 ---KESTV-------------PLTEMPGSLN------------GSKDVSNRAQTT---------- 510

  Fly   445 LTSGEKTVKGNATSVSVATGPQPRPPLPIVASQEQTIANLAPAGTVTVTATTAPTATTAATSVTS 509
                :.:::.::::.||        ||.|..|.|.:...| ..||...| |:..:..|...||.:
  Rat   511 ----DLSIQSDSSTASV--------PLEIEVSSEASDVWL-DLGTYLPT-TSGHSQPTHEDSVPA 561

  Fly   510 HKDKPNVADEEEDEDDDDDEEDEDGE 535
            |.|                 .|.||:
  Rat   562 HSD-----------------SDTDGQ 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C901NP_572673.1 DSL <56..79 CDD:302925 8/24 (33%)
EGF_CA 280..315 CDD:238011 14/39 (36%)
Cd93NP_445835.2 CLECT 30..183 CDD:413318
FXa_inhibition 261..297 CDD:405372 14/58 (24%)
EGF 303..331 CDD:394967 9/32 (28%)
cEGF 323..345 CDD:403760 6/26 (23%)
EGF_CA 342..372 CDD:214542 11/55 (20%)
EGF_CA 382..423 CDD:214542 12/43 (28%)
EGF_CA 424..462 CDD:214542 13/38 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 469..517 19/129 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..643
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.