DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C901 and DLK2

DIOPT Version :9

Sequence 1:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_005249365.1 Gene:DLK2 / 65989 HGNCID:21113 Length:476 Species:Homo sapiens


Alignment Length:342 Identity:101/342 - (29%)
Similarity:138/342 - (40%) Gaps:94/342 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HYVCDEKGDFKCLPGWQGDLCQVPMCRRGCDPMNGYCQRPGECRCRIGYSGELCDKCIPLPGCQH 123
            |.||     ..|:.|..|...:...|...||..:|.|...|.|||..|:.|..|::|:.:|||||
Human   102 HLVC-----LLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQH 161

  Fly   124 GGCTKPFECICKPGWAGLFC--TEPSCRTGCHSTRGYCEAPGECRCRIGYAGRTCSECATMPGCQ 186
            |.|.:|::|||..||||.||  .|..|     :|:..|:..|:|.    |.|          |.:
Human   162 GTCHQPWQCICHSGWAGKFCDKDEHIC-----TTQSPCQNGGQCM----YDG----------GGE 207

  Fly   187 HGTCNKPLECLCLPGYTGLLCQTPICDPDCSKQHGYCRKPGE-------------------CRCK 232
            :       .|:||||:.|         .||.::.|.|.:.|.                   |||.
Human   208 Y-------HCVCLPGFHG---------RDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCL 256

  Fly   233 VGWTGSQC----DKCFPYPGCANG----DCEAPWECNCHPGWGGMLCDEKLTYCVEHPDTCENGG 289
            ||:.|::|    |.|...| ||||    |....:.|.|..|:.|..|...|..|...|  |:.|.
Human   257 VGFVGARCEVNVDDCLMRP-CANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRP--CQRGA 318

  Fly   290 KCTSLSREDGSYQCQCRQGFLGKNCEIRDDFLLTSEAPPRI--TPPTPAELVLELDGELDQNGQQ 352
            :|.....:   :.|.|..|:.||.||:    :|....||..  ||..|...|:            
Human   319 RCRDRVHD---FDCLCPSGYGGKTCEL----VLPVPDPPTTVDTPLGPTSAVV------------ 364

  Fly   353 DIGAGVPDDSEPGGGLV 369
             :.|..|.....|.||:
Human   365 -VPATGPAPHSAGAGLL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C901NP_572673.1 DSL <56..79 CDD:302925 6/19 (32%)
EGF_CA 280..315 CDD:238011 9/34 (26%)
DLK2XP_005249365.1 EGF_CA 182..222 CDD:238011 16/74 (22%)
EGF_CA 267..303 CDD:238011 12/36 (33%)
EGF_CA 305..341 CDD:238011 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4501
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.