DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C901 and Megf6

DIOPT Version :9

Sequence 1:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_075244.1 Gene:Megf6 / 65049 RGDID:621188 Length:1574 Species:Rattus norvegicus


Alignment Length:433 Identity:108/433 - (24%)
Similarity:141/433 - (32%) Gaps:180/433 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CEKSQKQRQNAHYVCDEK-GDFKCLPGWQGDLCQV--------PMCRR--------GCDPMNGYC 95
            ||:|..:.      |:.| |...|..|:||:.||.        |.||.        .|||::|.|
  Rat   660 CEQSHTRS------CNPKDGSCSCKAGFQGERCQAECESGFFGPGCRHRCTCQPGVACDPVSGEC 718

  Fly    96 --QRP------------------------------------GECRCRIGYSGELCDKCIP----- 117
              |.|                                    |||.|..|.:||.|....|     
  Rat   719 RTQCPPGYQGEDCGQECPVGTFGVNCSGSCSCVGAPCHRVTGECLCPPGKTGEDCGADCPEGRWG 783

  Fly   118 ------LPGCQHGGCTKP--FECICKPGWAGLFCTEPSCR-----TGCH-----STRGYCE-APG 163
                  .|.|:||....|  ..|:|.||:.|..| :.:|.     |||.     :..|:|: ..|
  Rat   784 LGCQEICPACEHGASCNPETGTCLCLPGFVGSRC-QDTCSAGWYGTGCQIRCACANDGHCDPTTG 847

  Fly   164 ECRCRIGYAGRTCS----------ECATMPGCQ--HGTCNKPLE-CLCLPGYTGLLCQT------ 209
            .|.|..|:.|.:|.          :|.....|.  ||.|:.... |||..||.|..|:.      
  Rat   848 RCSCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPRCEQSCRQGY 912

  Fly   210 --PICDPDCSKQHGYC--RKPGECRCKVGWTGSQCDKCFPY------------------------ 246
              |.|:..|..:||..  ...|.|.|..||.||.|:...|.                        
  Rat   913 YGPSCEQKCRCEHGAACDHVSGACTCPAGWRGSFCEHACPAGFFGLDCDSACNCSAGAPCDAVTG 977

  Fly   247 ----------PGCA-------------------NG-DCEA-PWECNCHPGWGGMLCDEKLTYC-- 278
                      |.||                   || .|:: ..:|:|.|||.|..|   |..|  
  Rat   978 SCICPAGRWGPRCAQSCPPLTFGLNCSQICTCFNGASCDSVTGQCHCAPGWMGPTC---LQACPP 1039

  Fly   279 ------VEHPDTCENGGKCTSLSREDGSYQCQCRQGFLGKNCE 315
                  .:|...|.|||:|..:..     ||.|.:|:.|..||
  Rat  1040 GLYGKNCQHSCLCRNGGRCDPILG-----QCTCPEGWTGLACE 1077

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C901NP_572673.1 DSL <56..79 CDD:302925 7/23 (30%)
EGF_CA 280..315 CDD:238011 11/34 (32%)
Megf6NP_075244.1 EMI 42..112 CDD:284877
FXa_inhibition 127..162 CDD:291342
vWFA <154..202 CDD:294047
vWFA <237..285 CDD:294047
vWFA <284..325 CDD:294047
FXa_inhibition 338..373 CDD:291342
vWFA <371..410 CDD:294047
vWFA <413..452 CDD:294047
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1555..1574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8905
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.