DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C901 and dll4

DIOPT Version :9

Sequence 1:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001073304.1 Gene:dll4 / 563920 ZFINID:ZDB-GENE-041014-73 Length:683 Species:Danio rerio


Alignment Length:304 Identity:107/304 - (35%)
Similarity:140/304 - (46%) Gaps:45/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ACEKSQKQRQN--AHYVCDEKGDFKCLPGWQGDLCQVPMCRRGCDPMNGYCQRPGECRCRIGYSG 109
            :|.|....|.:  .||.|:..|...|||||:|:.|:.|:|..||...||.|.:||||.||.|:.|
Zfish   176 SCSKKCTPRDDRFGHYTCNPDGQLSCLPGWKGEYCEEPICLEGCSEANGNCSKPGECVCREGWQG 240

  Fly   110 ELCDKCIPLPGCQHGGCTKPFECICKPGWAGLFCTE--------PSCRTG--CHSTRGYCEAPGE 164
            :.|.:|...|.|:||.|..|.:|.||.||.||||.:        ..|..|  |.:|.   :....
Zfish   241 KFCTECKTYPACKHGTCHLPGQCNCKEGWGGLFCDQDLNFCTHHKPCVNGATCMNTG---QGSYT 302

  Fly   165 CRCRIGYAGRTCS----ECATMPGCQHGTC---NKPLECLCLPGYTGLLCQTPI---CDPDCSKQ 219
            |.||.||.|..|.    ||.:.|....|.|   :|...|.|||.:.|..|:..:   .|..|..:
Zfish   303 CICRPGYTGVNCELQVRECDSSPRKNGGLCTDHDKSYTCTCLPDFEGTHCEHSLLTCADSPCFHK 367

  Fly   220 HGYCRKPGE-----CRCKVGWTGSQC----DKCFPYPGCAN-GDC---EAPWECNCHPGWGGMLC 271
             |.|.:...     |.|.:|:||..|    |||.... ||| |.|   .....|:|..|:.|..|
Zfish   368 -GRCHEKDNGRSYACECPLGYTGLNCERRMDKCTSML-CANDGLCLILGGKRICSCRAGFTGQRC 430

  Fly   272 DEKLTYCVEHPDTCENGGKCTSLSREDGSYQCQCRQGFLGKNCE 315
            :..:..|..:|  |.|||.|.....|   |.|.|..|:.|:||:
Zfish   431 EININDCANNP--CANGGTCYDRINE---YVCSCPPGYKGRNCD 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C901NP_572673.1 DSL <56..79 CDD:302925 10/24 (42%)
EGF_CA 280..315 CDD:238011 13/34 (38%)
dll4NP_001073304.1 MNNL 22..83 CDD:284966
DSL 148..210 CDD:279722 13/33 (39%)
EGF_CA 277..315 CDD:238011 10/40 (25%)
EGF_CA 433..468 CDD:238011 13/39 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.