DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C901 and Dll4

DIOPT Version :9

Sequence 1:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_006234827.1 Gene:Dll4 / 311332 RGDID:1309740 Length:686 Species:Rattus norvegicus


Alignment Length:318 Identity:124/318 - (38%)
Similarity:160/318 - (50%) Gaps:55/318 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ACEKSQKQRQN--AHYVCDEKGDFKCLPGWQGDLCQVPMCRRGCDPMNGYCQRPGECRCRIGYSG 109
            :|.:..|:|.:  .||.|...|...|||||.|..|..|:|..||...||||.:|.||.||.|:.|
  Rat   184 SCSRLCKKRDDHFGHYECQPDGSLSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECNCRPGWQG 248

  Fly   110 ELCDKCIPLPGCQHGGCTKPFECICKPGWAGLFCTE--------PSCRTG--CHST--RGYCEAP 162
            .||::|||..||:||.||.|::|.|..||.||||.:        ..|:.|  |.::  |||    
  Rat   249 PLCNECIPHNGCRHGTCTIPWQCACDEGWGGLFCDQDLNYCTHHSPCKNGSTCSNSGPRGY---- 309

  Fly   163 GECRCRIGYAGRTC----SECATMPGCQHGTCNKPLE----CLCLPGYTGLLCQ--TPIC-DPDC 216
             .|.|..||.|..|    |:||:.| |::|...|..|    |||.|||.|..|:  |..| |..|
  Rat   310 -TCTCLPGYTGEHCELELSKCASNP-CRNGGSCKDHENSYHCLCPPGYYGQHCEHSTLTCADSPC 372

  Fly   217 SKQHGYCRKPGE-----CRCKVGWTGSQC----DKCFPYPGCAN-GDC--EAPWE-CNCHPGWGG 268
            . ..|.||:..:     |.|...:|||.|    |:|...| ||| |.|  ..|.. |.|.||:.|
  Rat   373 F-NGGSCRERNQGASYACECPPNFTGSNCEKKVDRCTSNP-CANGGQCLNRGPSRTCRCRPGFTG 435

  Fly   269 MLCDEKLTYCVEHPDTCENGGKCTSLSREDGSYQCQCRQGFLGKNCEIRDDFLLTSEA 326
            ..|:..::.|...|  |.:||.|..|  |:|.. |.|..||.|:.||:|    :|::|
  Rat   436 THCELHISDCARSP--CAHGGTCHDL--ENGPV-CTCPAGFSGRRCEVR----ITNDA 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C901NP_572673.1 DSL <56..79 CDD:302925 10/24 (42%)
EGF_CA 280..315 CDD:238011 13/34 (38%)
Dll4XP_006234827.1 MNNL 28..89 CDD:284966
DSL 156..218 CDD:279722 13/33 (39%)
EGF_CA 285..323 CDD:238011 11/42 (26%)
EGF_CA 329..361 CDD:238011 14/32 (44%)
EGF_CA <370..401 CDD:238011 9/31 (29%)
EGF_CA 404..439 CDD:238011 14/35 (40%)
EGF_CA 442..477 CDD:238011 14/39 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.