DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C901 and dlb

DIOPT Version :9

Sequence 1:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_571033.1 Gene:dlb / 30141 ZFINID:ZDB-GENE-980526-114 Length:615 Species:Danio rerio


Alignment Length:382 Identity:126/382 - (32%)
Similarity:171/382 - (44%) Gaps:80/382 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVTAITALKLEEMNAY---RRNFDARQSSNSNIPL---WKQ----------------------- 45
            |::.|..|...:|.:.|   :.|..:|.::...:.:   |.|                       
Zfish   102 LIIEAWNAESPKEHHDYTENQNNLISRLATRRRLAVGEDWSQDVHFGDQSELRYSYHVFCDEFYF 166

  Fly    46 -RACEKSQKQRQN--AHYVCDEKGDFKCLPGWQGDLCQVPMCRRGCDPMNGYCQRPGECRCRIGY 107
             .||....:.|.:  .||.|||.|:.:||.|||||.|..|:|...|...:|||:.||||:||:|:
Zfish   167 GEACSDYCRPRDDTLGHYTCDENGNKECLVGWQGDYCSDPICSSDCSERHGYCESPGECKCRLGW 231

  Fly   108 SGELCDKCIPLPGCQHGGCTKPFECICKPGWAGLFCTE--------PSCRTGCHSTRGYCEAPGE 164
            .|..|.:|:..|||.||.|::|::|:||.||.||||.:        ..|..|     ..|...|:
Zfish   232 QGPSCSECVHYPGCLHGTCSQPWQCVCKEGWGGLFCNQDLNYCTNHKPCANG-----ATCTNTGQ 291

  Fly   165 ----CRCRIGYAGRTC----SECATMPGCQHGTCN---KPLECLCLPGYTGLLCQ--TPICDPDC 216
                |.||.|:.|..|    :||...|....|:||   ....|.|..|:.|..|:  ...|..|.
Zfish   292 GSYTCTCRPGFGGTNCELEINECDCNPCKNGGSCNDLENDYSCTCPQGFYGKNCEIIAMTCADDP 356

  Fly   217 SKQHGYCRKPGE----CRCKVGWTGSQC----DKCFPYPGCANG----DCEAPWECNCHPGWGGM 269
            ....|.|.:...    |||...:|||.|    |:|...| ||||    |..|...|.|.||:.|.
Zfish   357 CFNGGTCEEKFTGGYVCRCPPTFTGSNCEKRLDRCSHKP-CANGGECVDLGASALCRCRPGFSGS 420

  Fly   270 LCDEKLTYCVEHPDTCENGGKCTSLSREDG--SYQCQCRQGFLGKNCEIRDDFLLTS 324
            .|:..:..|..:|  |:|.|.|     :||  .|.|.|..||.||||.:|.|..||:
Zfish   421 RCETNIDDCARYP--CQNAGTC-----QDGINDYTCTCTLGFTGKNCSLRADACLTN 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C901NP_572673.1 DSL <56..79 CDD:302925 13/24 (54%)
EGF_CA 280..315 CDD:238011 15/36 (42%)
dlbNP_571033.1 MNNL 21..75 CDD:284966
DSL 141..203 CDD:279722 18/61 (30%)
EGF_CA 270..308 CDD:238011 9/42 (21%)
EGF_CA 311..346 CDD:238011 10/34 (29%)
EGF_CA 392..423 CDD:238011 12/31 (39%)
EGF_CA 425..460 CDD:238011 15/41 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.