DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C901 and DLL1

DIOPT Version :9

Sequence 1:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_005609.3 Gene:DLL1 / 28514 HGNCID:2908 Length:723 Species:Homo sapiens


Alignment Length:549 Identity:155/549 - (28%)
Similarity:214/549 - (38%) Gaps:175/549 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CEKSQKQRQNA--HYVCDEKGDFKCLPGWQGDLCQVPMCRRGCDPMNGYCQRPGECRCRIGYSGE 110
            |....:.|.:|  |:.|.|:|:..|.|||:|..|..|:|..|||..:|:|.:||||:||:|:.|.
Human   188 CSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGR 252

  Fly   111 LCDKCIPLPGCQHGGCTKPFECICKPGWAGLFCTE--------PSCRTGCHSTRGYCEAPGE--- 164
            .||:||..|||.||.|.:|::|.|:.||.||||.:        ..|:.|     ..|...|:   
Human   253 YCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNG-----ATCTNTGQGSY 312

  Fly   165 -CRCRIGYAGRTC----SECATMPGCQHGTCNKPLE----CLCLPGYTGLLCQTPI--------- 211
             |.||.||.|.||    .||...| |::|.....||    |.|.||:.|.:|:...         
Human   313 TCSCRPGYTGATCELGIDECDPSP-CKNGGSCTDLENSYSCTCPPGFYGKICELSAMTCADGPCF 376

  Fly   212 ----C--DPD---------------CSKQHGYCRKP-----------GE---CRCKVGWTGSQC- 240
                |  .||               |.|:..||...           |:   |||:.|::|..| 
Human   377 NGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCVDLGDAYLCRCQAGFSGRHCD 441

  Fly   241 ---DKCFPYPGCANG----DCEAPWECNCHPGWGGMLCDEKLTYCVEHPDTCENGGKCTSLSRED 298
               |.|...| ||||    |....:.|.|.||:.|..|...::.|...|  |.||..|    .|.
Human   442 DNVDDCASSP-CANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAP--CHNGATC----HER 499

  Fly   299 G-SYQCQCRQGFLGKNCEIRDDFLLTSEAPPRITPPTPAELVLELDGELDQNGQQ----DIGAGV 358
            | .|.|:|.:|:.|.||:    |||     |.: ||.||  |::|..:|:..|..    .:.|||
Human   500 GHRYVCECARGYGGPNCQ----FLL-----PEL-PPGPA--VVDLTEKLEGQGGPFPWVAVCAGV 552

  Fly   359 --------------------------PDDSEPGGGLVGEKLPAGNEPE--------RRKNDTVAN 389
                                      |.|            |...|.|        :|:.|...:
Human   553 ILVLMLLLGCAAVVVCVRLRLQKHRPPAD------------PCRGETETMNNLANCQREKDISVS 605

  Fly   390 VATAGTGAGAGPMNSLPGNSNATRTTL----------VVATETGSDNATNEALSAVTTR------ 438
            :..|.............|:.:|.:...          :|....|.|.|..:|.|...|:      
Human   606 IIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSKRDTKCQPQGS 670

  Fly   439 ----RATPIPLTSGEKTVK-----GNATS 458
                :.||..|..||.:.:     |.:||
Human   671 SGEEKGTPTTLRGGEASERKRPDSGCSTS 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C901NP_572673.1 DSL <56..79 CDD:302925 10/24 (42%)
EGF_CA 280..315 CDD:238011 13/35 (37%)
DLL1NP_005609.3 MNNL 22..92 CDD:311545
DSL 159..221 CDD:128366 12/32 (38%)
EGF_CA 288..326 CDD:238011 11/42 (26%)
EGF_CA 329..364 CDD:238011 12/35 (34%)
EGF_CA <373..403 CDD:238011 3/29 (10%)
EGF_CA 406..440 CDD:238011 8/33 (24%)
EGF_CA 443..478 CDD:238011 13/35 (37%)
EGF_CA <489..517 CDD:238011 13/33 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 653..702 12/47 (26%)
Interaction with MAGI1. /evidence=ECO:0000250|UniProtKB:Q61483 720..723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.