DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C901 and arg-1

DIOPT Version :9

Sequence 1:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001024615.1 Gene:arg-1 / 180501 WormBaseID:WBGene00000185 Length:357 Species:Caenorhabditis elegans


Alignment Length:131 Identity:44/131 - (33%)
Similarity:61/131 - (46%) Gaps:14/131 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LECLCLPGYTGLLCQTPICDPDCSKQHGYCRKPGECRCKVGWTGSQCDK----CFPYPGCANGD- 253
            |..:|...|.|..|.. .|.|. ...|..|...|..:|.|||.|..|..    |.....||||. 
 Worm   127 LRNVCTSNYYGKRCNR-YCIPS-PALHWECSTNGVRQCAVGWYGDDCSSNIKFCSHQNPCANGGV 189

  Fly   254 CEAPWECNCHPGWGGMLCDEKLT--YC-VEHPDTCENGGKCTSLSREDGSYQCQCRQGFLGKNCE 315
            |...::|.|...:.|..|:..::  :| :|.  .|::||.|.|::|.  :.||:|.:||||..||
 Worm   190 CSTDYKCQCPSEFLGPRCETPVSKVHCTLER--VCKHGGTCVSVNRT--NVQCKCIRGFLGSLCE 250

  Fly   316 I 316
            |
 Worm   251 I 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C901NP_572673.1 DSL <56..79 CDD:302925
EGF_CA 280..315 CDD:238011 14/34 (41%)
arg-1NP_001024615.1 DSL 107..171 CDD:128366 15/45 (33%)
EGF_CA 174..208 CDD:238011 9/33 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.