DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C901 and dlc

DIOPT Version :9

Sequence 1:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001096242.1 Gene:dlc / 100124798 XenbaseID:XB-GENE-968497 Length:642 Species:Xenopus tropicalis


Alignment Length:427 Identity:130/427 - (30%)
Similarity:188/427 - (44%) Gaps:122/427 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVTAITALKLEEMN----------AYRRNFDARQSSNSNIPLWKQR-----------------A 47
            |::.:.|.:..|:..          |.||.....:..:.:|.|.:|.                 :
 Frog   103 LIIESWTTVSAEQSTENPDNLLSRLATRRRLSVGEDWSQDIHLGQQSELRYSYHVSCDEHYYGDS 167

  Fly    48 CEKSQKQRQN--AHYVCDEKGDFKCLPGWQGDLCQVPMCRRGCDPMNGYCQRPGECRCRIGYSGE 110
            |....:.|.:  .||.|||:|:..||.||:|:.|..|:|..||...:|:|:.||||:||:|:.|:
 Frog   168 CSDYCRPRDDNFGHYTCDEQGNRLCLSGWKGEYCAEPICLPGCSESHGFCEIPGECKCRMGWQGQ 232

  Fly   111 LCDKCIPLPGCQHGGCTKPFECICKPGWAGLFCTEP--------SCRTG--CHSTRGYCEAPGEC 165
            |||:|:..||||||.|::|:||||:.||.||||.:.        .||.|  |.:|.   :....|
 Frog   233 LCDECVRYPGCQHGSCSQPWECICQEGWGGLFCNQDLNYCTNHRPCRNGASCINTG---QGSYSC 294

  Fly   166 RCRIGYAGRTC----SECATMPGCQHGTCN---KPLECLCLPGY--------------------- 202
            .||.|:.|..|    :|||:.|....|:||   ...||:|..|:                     
 Frog   295 NCRAGFTGTNCEIDINECASNPCKNGGSCNDLENDYECVCPRGFYGKNCDISAMTCEDGPCFNGG 359

  Fly   203 --------TGLLCQTPI--CDPDCSKQ-----------HGYCRKPGE---CRCKVGWTGSQC--- 240
                    .|.:|:.|:  ...:|.|:           .|.|...|.   |:|:.|::|.:|   
 Frog   360 TCIEKSSGVGYICRCPLNYHGSNCEKKIDRCTNSPCLNGGQCLDMGRNVLCKCRPGFSGPRCELN 424

  Fly   241 -DKCFPYPGCANG----DCEAPWECNCHPGWGGMLCDEKLTYCVEHPDTCENGGKC-TSLSREDG 299
             |.|...| ||||    |....:.|:|..|:||..|..::..|...|  |.|||.| |..|    
 Frog   425 IDDCASNP-CANGGTCVDAVNSYTCSCTLGYGGKDCTLRVDACSSQP--CSNGGTCFTHFS---- 482

  Fly   300 SYQCQCRQGFLGKNCEIRDDFLLTSEAPPRITPPTPA 336
            .:.|||..||:|.:||.            |:..||||
 Frog   483 GHVCQCPTGFMGTSCEF------------RVHDPTPA 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C901NP_572673.1 DSL <56..79 CDD:302925 11/24 (46%)
EGF_CA 280..315 CDD:238011 14/35 (40%)
dlcNP_001096242.1 MNNL 22..76 CDD:284966
DSL 139..201 CDD:279722 16/61 (26%)
EGF_CA 268..306 CDD:238011 10/40 (25%)
EGF_CA 308..343 CDD:238011 11/34 (32%)
EGF_CA 387..422 CDD:238011 7/34 (21%)
EGF_CA 424..460 CDD:238011 13/36 (36%)
EGF_CA 463..498 CDD:238011 15/40 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.