Sequence 1: | NP_076919.1 | Gene: | HOXA6 / 3203 | HGNCID: | 5107 | Length: | 233 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_536752.1 | Gene: | Ubx / 42034 | FlyBaseID: | FBgn0003944 | Length: | 389 | Species: | Drosophila melanogaster |
Alignment Length: | 382 | Identity: | 110/382 - (28%) |
---|---|---|---|
Similarity: | 134/382 - (35%) | Gaps: | 164/382 - (42%) |
- Green bases have known domain annotations that are detailed below.
Human 1 MSSYFV-------NPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGAS-----SLPDKTYT 53
Human 54 SPCFYQQSNSVLACNRASYEYGASCFYSD------------KDL--SGASPSGSG---------- 94
Human 95 ------------------KQRGPGDYLHFSPEQQYKPDS-------------------------- 115
Human 116 -SSGQGKA----------------------------------LHDEGADRKYTSPVYPWMQRMNS 145
Human 146 C-------------------------------AGAV----YGSHG--RRGRQTYTRYQTLELEKE 173
Human 174 FHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAK 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXA6 | NP_076919.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 89..127 | 15/126 (12%) | |
Antp-type hexapeptide | 136..141 | 3/4 (75%) | |||
Homeobox | 159..212 | CDD:365835 | 47/52 (90%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 214..233 | 2/17 (12%) | |||
Ubx | NP_536752.1 | Homeobox | 299..352 | CDD:395001 | 47/52 (90%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45659 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.000 |