DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA6 and Ubx

DIOPT Version :9

Sequence 1:NP_076919.1 Gene:HOXA6 / 3203 HGNCID:5107 Length:233 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:382 Identity:110/382 - (28%)
Similarity:134/382 - (35%) Gaps:164/382 - (42%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSSYFV-------NPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGAS-----SLPDKTYT 53
            |:|||.       :|.....:..|......|..  .|...|.|.||.|.|.|     .|...|..
  Fly     1 MNSYFEQASGFYGHPHQATGMAMGSGGHHDQTA--SAAAAAYRGFPLSLGMSPYANHHLQRTTQD 63

Human    54 SPCFYQQSNSVLACNRASYEYGASCFYSD------------KDL--SGASPSGSG---------- 94
            ||  |..|.:. |||:. |..||..:..|            ||:  :|.|..|.|          
  Fly    64 SP--YDASITA-ACNKI-YGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGGGGGGGGGGGGGA 124

Human    95 ------------------KQRGPGDYLHFSPEQQYKPDS-------------------------- 115
                              .|..|...:...| ....|||                          
  Fly   125 GGTGGAGNANGGNAANANGQNNPAGGMPVRP-SACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVS 188

Human   116 -SSGQGKA----------------------------------LHDEGADRKYTSPVYPWMQRMNS 145
             |.|.|.|                                  || :.::..:    ||||.....
  Fly   189 VSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLH-QASNHTF----YPWMAIAGE 248

Human   146 C-------------------------------AGAV----YGSHG--RRGRQTYTRYQTLELEKE 173
            |                               ||::    .|::|  ||||||||||||||||||
  Fly   249 CPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKE 313

Human   174 FHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAK 230
            ||.|.|||||||||:|:|||||||||||||||||||.|||.:.|.......:.::|:
  Fly   314 FHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA6NP_076919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..127 15/126 (12%)
Antp-type hexapeptide 136..141 3/4 (75%)
Homeobox 159..212 CDD:365835 47/52 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..233 2/17 (12%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.