DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA6 and Antp

DIOPT Version :9

Sequence 1:NP_076919.1 Gene:HOXA6 / 3203 HGNCID:5107 Length:233 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:241 Identity:99/241 - (41%)
Similarity:116/241 - (48%) Gaps:69/241 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSSYFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKT-----YTSPCFYQQ 60
            ||.:.:|...  :||    ..:|. |..|.||..:          .:||.|     :.:...|||
  Fly   186 MSGHHMNAQM--TLP----HHMGH-PQAQLGYTDV----------GVPDVTEVHQNHHNMGMYQQ 233

Human    61 SNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQ-RGPGDYLHFSPEQQYKPDS------SSG 118
            .:.|...                   ||.|.|...| :|| ..:|.....|:.|.|      |||
  Fly   234 QSGVPPV-------------------GAPPQGMMHQGQGP-PQMHQGHPGQHTPPSQNPNSQSSG 278

Human   119 QGKALHDEGADRKYTSPVYPWMQ-RMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTR 182
            .             .||:||||: :...|      ...:||||||||||||||||||||||||||
  Fly   279 M-------------PSPLYPWMRSQFGKC------QERKRGRQTYTRYQTLELEKEFHFNRYLTR 324

Human   183 RRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSE 228
            |||||||:|||||||||||||||||||||||||........||..|
  Fly   325 RRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA6NP_076919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..127 12/44 (27%)
Antp-type hexapeptide 136..141 3/4 (75%)
Homeobox 159..212 CDD:365835 51/52 (98%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..233 5/15 (33%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 44/175 (25%)
Homeobox 301..354 CDD:395001 51/52 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2625
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.