DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA6 and Scr

DIOPT Version :9

Sequence 1:NP_076919.1 Gene:HOXA6 / 3203 HGNCID:5107 Length:233 Species:Homo sapiens
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:134 Identity:76/134 - (56%)
Similarity:95/134 - (70%) Gaps:11/134 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    91 SGSGKQRGPGDY---LHFSP---EQQYKPDSSSGQGKALHDEGADRKYTSPVYPWMQRMNSCAGA 149
            ||||...|||:.   :| ||   :...:.||.:..|.: .:.|..:|....:||||:|::.....
  Fly   255 SGSGVSGGPGNVNVPMH-SPGGGDSDSESDSGNEAGSS-QNSGNGKKNPPQIYPWMKRVHLGTST 317

Human   150 VYGSHG--RRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKK 212
            | .::|  :|.|.:||||||||||||||||||||||||||||:||||||||||||||||||||||
  Fly   318 V-NANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 381

Human   213 ENKL 216
            |:|:
  Fly   382 EHKM 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA6NP_076919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..127 13/41 (32%)
Antp-type hexapeptide 136..141 3/4 (75%)
Homeobox 159..212 CDD:365835 49/52 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..233 1/3 (33%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.