DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myo10A and YPR089W

DIOPT Version :9

Sequence 1:NP_001036269.2 Gene:Myo10A / 32028 FlyBaseID:FBgn0263705 Length:3145 Species:Drosophila melanogaster
Sequence 2:NP_015414.2 Gene:YPR089W / 856204 SGDID:S000006293 Length:888 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:66/327 - (20%)
Similarity:116/327 - (35%) Gaps:99/327 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  2402 PAALQLNLRNGKH-------LALHAARAAAIQS--MVTTFVQEFRKSQSKASTLSSGARAAAQTL 2457
            |:.|| .|.|..|       .::|....:.|.|  :..|.:|:.:::..|            :..
Yeast   389 PSVLQ-ELINTIHSIIIELTSSIHCRLISLIDSTLLAYTTIQDVKQTLYK------------RDW 440

  Fly  2458 NVPLERLESRQAHAQRNEHGVDGGSRQNEQLQQSELHHHLQQQQQQQQQQQHHQQQQQQQQLEDA 2522
            |...:|.:::....::|.       :|.::.|:.|||       ::.|.|::|::::.||...|:
Yeast   441 NFFKKRKQAKLLLKEKNR-------KQLKEQQKKELH-------RKSQGQENHEEEEGQQDGNDS 491

  Fly  2523 MEEQHMATDHQQQQQQQLGQQQGQQQRFLKQQSYLHSARKSNAGQ-QPSSLTNGQVH-------- 2578
              :...:|:........|         |..::...|....|...| :||.|...|:.        
Yeast   492 --DDRASTNDDNNSSVSL---------FYDKEILRHLYPPSFEEQMKPSPLKIVQIFGALSYVLN 545

  Fly  2579 -HQEQMLQQQQQQSQSLPHHDLDANYLQDESNGGTPPSVTKYSLLQFAMQHFRNDQLRDADRH-- 2640
             ||...:.|||..|       :..|:                    ||...| |..|:|..:.  
Yeast   546 LHQTHPIFQQQCLS-------ISVNW--------------------FATTLF-NKILKDKKKRSL 582

  Fly  2641 HERHQSAANRSYAELVKW-QGHAIRLPLLRLPNDLA----PLALECFDCILRYCGDIPL-DPDLT 2699
            ...|......:.:.|..| |.:...:|...|.:|..    |:.|      :|..|:|.| ||.|.
Yeast   583 SRAHAIQIRLNLSTLESWIQNNDFCVPKPMLIDDFMWQRFPMTL------IRDVGEIDLSDPILR 641

  Fly  2700 EV 2701
            .|
Yeast   642 NV 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myo10ANP_001036269.2 MYSc 156..836 CDD:214580
MYSc_Myo15 169..828 CDD:276838
MyTH4 1014..1171 CDD:295320
MyTH4 2704..2810 CDD:279165
B41 2823..3033 CDD:214604
FERM_B-lobe 2920..3025 CDD:271216
FERM_C_MyoXV 3029..3138 CDD:270022
YPR089WNP_015414.2 Ank_2 67..152 CDD:423045
Myo5p-like_CBD_DIL_ANK 275..776 CDD:271257 66/327 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000014
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.