DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myo10A and PLEKHH3

DIOPT Version :9

Sequence 1:NP_001036269.2 Gene:Myo10A / 32028 FlyBaseID:FBgn0263705 Length:3145 Species:Drosophila melanogaster
Sequence 2:XP_016880602.1 Gene:PLEKHH3 / 79990 HGNCID:26105 Length:882 Species:Homo sapiens


Alignment Length:614 Identity:148/614 - (24%)
Similarity:223/614 - (36%) Gaps:164/614 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  2604 LQD-ESNGGTPPSVTKYSLLQFAMQHFRNDQLRDADRHHERHQSAANRSYAELVKWQGHAIRLPL 2667
            |:| :.:.|.|.:|        |:.:.||..|        ||.|.|  .||            ||
Human   301 LRDIQESCGDPEAV--------ALIYLRNPIL--------RHTSGA--LYA------------PL 335

  Fly  2668 LRLPNDL-------APLALECFDCIL--------RYCGDIPLDPDLTEVKCVYTVLMHCHKYLAL 2717
            |.||..:       |||..|.....|        |..|  ||         :..||..|....||
Human   336 LPLPYGVSAPGPGYAPLREEAVRLFLALQALEGARRPG--PL---------MQGVLQTCRDLPAL 389

  Fly  2718 RDEVYCQLMKQTTANRSP--CP----DSSQRAWRLLSILAAYFGCSDALRPYLMEHL---TSAAS 2773
            |||::.||.|||:....|  .|    .::.|.|:||:.::..|....|:|.:|:.||   ..|..
Human   390 RDELFLQLAKQTSGPAGPPGLPATQDPAALRYWQLLTCMSCTFRPGGAVRGHLLGHLERTEQALP 454

  Fly  2774 DRRRSCHGTAAVCLTNLRKT-ARCGGRKNVPSVEEVTAVSAGRSARRQIYRLPGGAERVVNTRCS 2837
            |      ...|.....:||. .|..||:.|||:.|::|:|..:.....:: .||.....|.....
Human   455 D------SELAEYARFIRKALGRTRGRELVPSLAEISALSQRQELLCTVH-CPGAGACAVAIDSH 512

  Fly  2838 TVVADVIAELCALLGVESEAEQQEFSLYCIVQGDAFTMPLAADEYILDVTT--ELLKSGQPFYLI 2900
            |...:|..||...||:  ...:..|:||  .|..|....||....:.||.|  |.|.:.:.....
Human   513 TTAGEVARELVGRLGL--ARSRNAFALY--EQRGAQERALAGGTLVADVLTRFENLAAEEAGLED 573

  Fly  2901 FCRSVWHFALKREPAPMPLYVEVLFNQVAPD-------YLEGLLLELPGNGVPVPEMVRDMA--R 2956
            ...|.|...|:...   ||:.|.|    :||       :.:...|.|.|...|..:.:|.:|  |
Human   574 SPDSGWRLCLRLHG---PLHPEGL----SPDGHELPFLFEQAHALLLRGRPPPPDDTLRALAALR 631

  Fly  2957 IAALLHRAADLSHVPAMKEIKFLLPKPALGIREIRP---------------AQW----------- 2995
            :.:|   ..|.|....:..:..|||.|| ..||..|               |.|           
Human   632 LQSL---QRDFSPRVPLPRLDRLLPPPA-PPREDPPRPTPRPPPSAALLAGALWSPGLAKRRAER 692

  Fly  2996 -----------------------VGLVQSAWPQVANLSPGQVKAQFLNVLATWPLFGSSFFAVKR 3037
                                   ...|...|.::..:...:..|.:|.:.|..|.||::.:.|..
Human   693 ARRGGAGRTAGSIAREGGGGAGTAAAVLGGWKRLRGMGRAEAMAAYLALAAQCPGFGAARYDVLE 757

  Fly  3038 IWAEEGPHVEDNHSPMWRDLILALNRRGVLFLDPNTHETLQHWSFMEVISTRKVRSEDGALFLDM 3102
            :..|.|     ..:|  :.|.|.|..:.:....|...|.:...|:..|.:.:.:    |...|.:
Human   758 LSTEPG-----RGAP--QKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLM----GPHTLAL 811

  Fly  3103 KVGNLMQQRVIRVQTEQAHEISRLVRQYI 3131
            :||    :..:.:|:.|..||.:||..|:
Human   812 RVG----ESQLLLQSPQVEEIMQLVNAYL 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myo10ANP_001036269.2 MYSc 156..836 CDD:214580
MYSc_Myo15 169..828 CDD:276838
MyTH4 1014..1171 CDD:295320
MyTH4 2704..2810 CDD:279165 37/115 (32%)
B41 2823..3033 CDD:214604 58/269 (22%)
FERM_B-lobe 2920..3025 CDD:271216 29/162 (18%)
FERM_C_MyoXV 3029..3138 CDD:270022 23/103 (22%)
PLEKHH3XP_016880602.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4229
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.