Sequence 1: | NP_001036269.2 | Gene: | Myo10A / 32028 | FlyBaseID: | FBgn0263705 | Length: | 3145 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_574090.6 | Gene: | Myo3a / 498806 | RGDID: | 1560083 | Length: | 268 | Species: | Rattus norvegicus |
Alignment Length: | 199 | Identity: | 39/199 - (19%) |
---|---|---|---|
Similarity: | 63/199 - (31%) | Gaps: | 74/199 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 270 GGSASAVITEQILEAAPLLEAFGNARTARNDNSSRFGKYLEVYFKSGAIVGAKITQYLLEKSRIV 334
Fly 335 TQAPGERNYHVFYELLGGLSETERSKYGLLEADKYFYLNQGATDCASGRVDWESLQGAMQVLGVS 399
Fly 400 EGEREGIVRVLAAVLH---LGNVYFHRRQLRH--------------GQEGVEVGSDAEIKWAAHL 447
Fly 448 LHIS 451 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Myo10A | NP_001036269.2 | MYSc | 156..836 | CDD:214580 | 39/199 (20%) |
MYSc_Myo15 | 169..828 | CDD:276838 | 39/199 (20%) | ||
MyTH4 | 1014..1171 | CDD:295320 | |||
MyTH4 | 2704..2810 | CDD:279165 | |||
B41 | 2823..3033 | CDD:214604 | |||
FERM_B-lobe | 2920..3025 | CDD:271216 | |||
FERM_C_MyoXV | 3029..3138 | CDD:270022 | |||
Myo3a | XP_574090.6 | PKc_like | 2..258 | CDD:419665 | 39/199 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |