DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2145 and Endou

DIOPT Version :9

Sequence 1:NP_001285102.1 Gene:CG2145 / 32027 FlyBaseID:FBgn0030251 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001177998.1 Gene:Endou / 680317 RGDID:1593011 Length:411 Species:Rattus norvegicus


Alignment Length:303 Identity:103/303 - (33%)
Similarity:155/303 - (51%) Gaps:26/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 GSSVGPHKDGGGGGGGGTTTVRPGFQSSGNSVATDDEIRQLTELLYTKESN-SQIGNIQVNLQGR 359
            |:..|.|:               ||..|.::: |.:|::.::|.:|..:.| :|..:|.:|.|.:
  Rat   120 GNLCGDHE---------------GFSHSSDAI-TKEELKSISETIYRVDINKAQKKDIVLNSQNQ 168

  Fly   360 TRSIDS---ADEAPNPLLT-VDSKALESPTIVKMRLLFNNYEHDTHVNEHVTPNERKEENDFLDA 420
            ....::   .|..|.||.. |:.|....||......|.|||:..|...||.:..:.:|:..||..
  Rat   169 ISPAETGNQVDRCPEPLFKYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQQLEEQVVFLRE 233

  Fly   421 VMATPVMRQAMLFLQQKGVVSPDPKTHRDLVKELWFTQYSRGQGKIGSSGFEHVFVYEVKDGTII 485
            ||.|.||::...||:.:.......:...|| |.:||..||||..:..||||||||..|||.|.:.
  Rat   234 VMKTAVMKELYSFLRHQNRYGSQQEFVEDL-KNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVT 297

  Fly   486 GFHNWVYIGDEEKDGRFDYKGYMKEQDIGTKGKIVKIRFSHQGLNKPVNTVFVGTSPELELALYT 550
            |||||:....:||:|..||..:..:....:...::.::|:..|..|.|.:||:|:|||.|.|||:
  Rat   298 GFHNWIRFYLQEKEGLLDYYSHNYDGPWDSYPDVLAMQFNWDGYYKEVGSVFIGSSPEFEFALYS 362

  Fly   551 VCFQLRPDRTCPVSLGNSKFGIVTYSW---RY-RGKNLIGSAY 589
            :||..||.:.|.:|||.....|.||:|   .| .||..|.:||
  Rat   363 LCFITRPGKKCHLSLGGYPLAIQTYTWDKTTYGNGKKYIATAY 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2145NP_001285102.1 XendoU 330..590 CDD:286496 96/269 (36%)
EndouNP_001177998.1 Somatomedin_B 22..60 CDD:279385
Somatomedin_B 88..125 CDD:279385 1/4 (25%)
XendoU 139..405 CDD:286496 94/266 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352173
Domainoid 1 1.000 161 1.000 Domainoid score I3916
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48394
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D596408at33208
OrthoFinder 1 1.000 - - FOG0003014
OrthoInspector 1 1.000 - - otm45493
orthoMCL 1 0.900 - - OOG6_102937
Panther 1 1.100 - - LDO PTHR12439
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.