DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2145 and endouc

DIOPT Version :9

Sequence 1:NP_001285102.1 Gene:CG2145 / 32027 FlyBaseID:FBgn0030251 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001038439.1 Gene:endouc / 562040 ZFINID:ZDB-GENE-060503-141 Length:309 Species:Danio rerio


Alignment Length:286 Identity:100/286 - (34%)
Similarity:148/286 - (51%) Gaps:19/286 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 SSGNSVATDDEIRQLTELLYTKESN--SQIGNIQVNLQGRT-----RSIDSADEAPNPL-LTVDS 378
            :..:|...:.|:..:...|:..:.|  ..:.|..::|||:.     .|.:..|.|.:|| :.||.
Zfish    20 TDASSQTVNQELSNIFNELWKLDVNRMEPLTNYNISLQGKAGYIPQGSTNVVDHASSPLFVNVDE 84

  Fly   379 KALES-PTIVKMRLLFNNYEHDTHVNEHVTPNERKEENDFLDAVMATPVMRQAMLFLQQKGVVSP 442
            ..|.| .|..:...|.:|||..|.|.|.||..|..|.|.||||::.|.||::|..:|..||....
Zfish    85 AKLSSITTYARFMKLLDNYERSTGVAERVTAEEVTENNSFLDAILETAVMKRAHQYLIGKGKSRS 149

  Fly   443 DPKTHRDLVKELWFTQYSRGQ-GKIGSSGFEHVFVYEVKDG-TIIGFHNWVYIGDEEKDGRFDYK 505
            |.:..:..:..:||..|.|.: |...|||||||||.|.|.| .|:|.||||....:||....|||
Zfish   150 DLRQFKSQLYYMWFRLYHRERNGGEDSSGFEHVFVGETKFGREIMGLHNWVQFYLQEKQNLLDYK 214

  Fly   506 GY-MKEQDI-GTKGKIVKIRFSHQGLNKPVNTVFVGTSPELELALYTVCFQLRPDR--TCPVSLG 566
            || .:..|: .....::.::||..||.|||.:.|||.|||.|:|::|:.|....::  |..|:|.
Zfish   215 GYKARANDVPDADDHVLNVQFSWHGLVKPVASAFVGVSPEFEMAVFTILFLTSTEKTTTAVVNLD 279

  Fly   567 NSKFGIVTYSWRYRGKNLIGSAYPEI 592
            ..:..:|.    :|....||:|||::
Zfish   280 EYQLEMVV----HRHGRCIGTAYPKL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2145NP_001285102.1 XendoU 330..590 CDD:286496 97/274 (35%)
endoucNP_001038439.1 XendoU 28..299 CDD:286496 97/274 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D596408at33208
OrthoFinder 1 1.000 - - FOG0003014
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102937
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.